SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP30307_P050-FITC
Size:100ul
Price: $434.00
SKU
ARP30307_P050-FITC
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

TP53 Antibody - N-terminal region : FITC (ARP30307_P050-FITC)

Datasheets/ManualsPrintable datasheet for anti-TP53 (ARP30307_P050-FITC) antibody
Product Info
Predicted Species ReactivityHuman, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationFITC: Fluorescein Isothiocyanate
ApplicationCHIP, IHC, WB
Additional InformationIHC Information: Skin
IHC Information: Kidney
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human TP53
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 80%; Guinea Pig: 90%; Horse: 90%; Human: 100%; Pig: 100%; Rabbit: 100%; Rat: 90%; Sheep: 100%
Peptide SequenceSynthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE
Concentration0.5 mg/ml
Blocking PeptideFor anti-TP53 (ARP30307_P050-FITC) antibody is Catalog # AAP30307 (Previous Catalog # AAPS08710)
Sample Type Confirmation

TP53 is strongly supported by BioGPS gene expression data to be expressed in 721_B, HEK293T

ReferenceBoehme,K.A., (2008) Proc. Natl. Acad. Sci. U.S.A. 105 (22), 7785-7790
Gene SymbolTP53
Alias SymbolsP53, BCC7, LFS1, BMFS5, TRP53
NCBI Gene Id7157
Protein NameCellular tumor antigen p53
Description of TargetTP53 acts as a tumor suppressor in many tumor types; induces growth arrest or apoptosis depending on the physiological circumstances and cell type. Involved in cell cycle regulation as a trans-activator that acts to negatively regulate cell division by controlling a set of genes required for this process. This gene encodes tumor protein p53, which responds to diverse cellular stresses to regulate target genes that induce cell cycle arrest, apoptosis, senescence, DNA repair, or changes in metabolism. p53 protein is expressed at low level in normal cells and at a high level in a variety of transformed cell lines, where it's believed to contribute to transformation and malignancy. p53 is a DNA-binding protein containing transcription activation, DNA-binding, and oligomerization domains. It is postulated to bind to a p53-binding site and activate expression of downstream genes that inhibit growth and/or invasion, and thus function as a tumor suppressor. Mutants of p53 that frequently occur in a number of different human cancers fail to bind the consensus DNA binding site, and hence cause the loss of tumor suppressor activity. Alterations of this gene occur not only as somatic mutations in human malignancies, but also as germline mutations in some cancer-prone families with Li-Fraumeni syndrome. Multiple p53 variants due to alternative promoters and multiple alternative splicing have been found. These variants encode distinct isoforms, which can regulate p53 transcriptional activity.
Uniprot IDP04637
Protein Accession #NP_000537
Nucleotide Accession #NM_000546
Protein Size (# AA)393
Molecular Weight44kDa
  1. What is the species homology for "TP53 Antibody - N-terminal region : FITC (ARP30307_P050-FITC)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep".

  2. How long will it take to receive "TP53 Antibody - N-terminal region : FITC (ARP30307_P050-FITC)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "TP53 Antibody - N-terminal region : FITC (ARP30307_P050-FITC)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "TP53 Antibody - N-terminal region : FITC (ARP30307_P050-FITC)"?

    This target may also be called "P53, BCC7, LFS1, BMFS5, TRP53" in publications.

  5. What is the shipping cost for "TP53 Antibody - N-terminal region : FITC (ARP30307_P050-FITC)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "TP53 Antibody - N-terminal region : FITC (ARP30307_P050-FITC)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "TP53 Antibody - N-terminal region : FITC (ARP30307_P050-FITC)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "44kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "TP53 Antibody - N-terminal region : FITC (ARP30307_P050-FITC)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "TP53"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "TP53"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "TP53"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "TP53"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "TP53"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "TP53"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:TP53 Antibody - N-terminal region : FITC (ARP30307_P050-FITC)
Your Rating
We found other products you might like!