- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
TP53 Antibody - N-terminal region : Biotin (ARP30307_P050-Biotin)
Datasheets/Manuals | Printable datasheet for anti-TP53 (ARP30307_P050-Biotin) antibody |
---|
Predicted Species Reactivity | Human, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep |
---|---|
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
Clonality | Polyclonal |
Host | Rabbit |
Conjugation | Biotin |
Application | CHIP, IHC, WB |
Additional Information | IHC Information: Skin IHC Information: Kidney |
Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human TP53 |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 80%; Guinea Pig: 90%; Horse: 90%; Human: 100%; Pig: 100%; Rabbit: 100%; Rat: 90%; Sheep: 100% |
Peptide Sequence | Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-TP53 (ARP30307_P050-Biotin) antibody is Catalog # AAP30307 (Previous Catalog # AAPS08710) |
Sample Type Confirmation | TP53 is strongly supported by BioGPS gene expression data to be expressed in 721_B, HEK293T |
Reference | Boehme,K.A., (2008) Proc. Natl. Acad. Sci. U.S.A. 105 (22), 7785-7790 |
Gene Symbol | TP53 |
---|---|
Alias Symbols | P53, BCC7, LFS1, BMFS5, TRP53 |
NCBI Gene Id | 7157 |
Protein Name | Cellular tumor antigen p53 |
Description of Target | TP53 acts as a tumor suppressor in many tumor types; induces growth arrest or apoptosis depending on the physiological circumstances and cell type. Involved in cell cycle regulation as a trans-activator that acts to negatively regulate cell division by controlling a set of genes required for this process. This gene encodes tumor protein p53, which responds to diverse cellular stresses to regulate target genes that induce cell cycle arrest, apoptosis, senescence, DNA repair, or changes in metabolism. p53 protein is expressed at low level in normal cells and at a high level in a variety of transformed cell lines, where it's believed to contribute to transformation and malignancy. p53 is a DNA-binding protein containing transcription activation, DNA-binding, and oligomerization domains. It is postulated to bind to a p53-binding site and activate expression of downstream genes that inhibit growth and/or invasion, and thus function as a tumor suppressor. Mutants of p53 that frequently occur in a number of different human cancers fail to bind the consensus DNA binding site, and hence cause the loss of tumor suppressor activity. Alterations of this gene occur not only as somatic mutations in human malignancies, but also as germline mutations in some cancer-prone families with Li-Fraumeni syndrome. Multiple p53 variants due to alternative promoters and multiple alternative splicing have been found. These variants encode distinct isoforms, which can regulate p53 transcriptional activity. |
Uniprot ID | P04637 |
Protein Accession # | NP_000537 |
Nucleotide Accession # | NM_000546 |
Protein Size (# AA) | 393 |
Molecular Weight | 44kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "TP53 Antibody - N-terminal region : Biotin (ARP30307_P050-Biotin)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep".
-
How long will it take to receive "TP53 Antibody - N-terminal region : Biotin (ARP30307_P050-Biotin)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "TP53 Antibody - N-terminal region : Biotin (ARP30307_P050-Biotin)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "TP53 Antibody - N-terminal region : Biotin (ARP30307_P050-Biotin)"?
This target may also be called "P53, BCC7, LFS1, BMFS5, TRP53" in publications.
-
What is the shipping cost for "TP53 Antibody - N-terminal region : Biotin (ARP30307_P050-Biotin)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "TP53 Antibody - N-terminal region : Biotin (ARP30307_P050-Biotin)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "TP53 Antibody - N-terminal region : Biotin (ARP30307_P050-Biotin)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "44kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "TP53 Antibody - N-terminal region : Biotin (ARP30307_P050-Biotin)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "TP53"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "TP53"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "TP53"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "TP53"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "TP53"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "TP53"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.