- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for SRF Antibody (OAAL00313) |
---|
Predicted Species Reactivity | Human, Mouse |
---|---|
Product Format | Liquid |
Clonality | Monoclonal |
Clone | 1C8 |
Isotype | IgG2a Kappa |
Host | Mouse |
Application | ELISA, WB |
Reconstitution and Storage | Store at -20C or lower. Aliquot to avoid repeated freezing and thawing. |
Immunogen | SRF (AAH48211, 406 a.a. ~ 508 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Peptide Sequence | HMMYPSPHAVMYAPTSGLGDGSLTVLNAFSQAPSTMQVSHSQVQEPGGVPQVFLTASSGTVQIPVSAVQLHQMAVIGQQAGSSSNLTELQVVNLDTAHSTKSE |
Formulation | In 1x PBS, pH 7.4 |
Gene Symbol | SRF |
---|---|
Gene Full Name | serum response factor |
Alias Symbols | c-fos serum response element-binding transcription factor;MCM1;minichromosome maintenance 1 homolog;serum response factor. |
NCBI Gene Id | 6722 |
Protein Name | Homo sapiens serum response factor (c-fos serum response element-binding transcription factor), mRNA (cDNA clone MGC:52246 IMAGE:5808348), complete cds|Serum response factor (c-fos serum response element-binding transcription factor) [Homo sapiens] |
Description of Target | This gene encodes a ubiquitous nuclear protein that stimulates both cell proliferation and differentiation. It is a member of the MADS (MCM1, Agamous, Deficiens, and SRF) box superfamily of transcription factors. This protein binds to the serum response element (SRE) in the promoter region of target genes. This protein regulates the activity of many immediate-early genes, for example c-fos, and thereby participates in cell cycle regulation, apoptosis, cell growth, and cell differentiation. This gene is the downstream target of many pathways; for example, the mitogen-activated protein kinase pathway (MAPK) that acts through the ternary complex factors (TCFs). [provided by RefSeq |
Protein Accession # | https://www.ncbi.nlm.nih.gov/protein/AAH48211 |
Nucleotide Accession # | https://www.ncbi.nlm.nih.gov/nuccore/BC048211 |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "SRF Antibody (OAAL00313)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse".
-
How long will it take to receive "SRF Antibody (OAAL00313)"?
This item is available "Domestic: within 2-3 week delivery | International: 2-3 weeks".
-
What buffer format is "SRF Antibody (OAAL00313)" provided in?
This item is provided in "Liquid".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "SRF Antibody (OAAL00313)"?
This target may also be called "c-fos serum response element-binding transcription factor;MCM1;minichromosome maintenance 1 homolog;serum response factor." in publications.
-
What is the shipping cost for "SRF Antibody (OAAL00313)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "SRF Antibody (OAAL00313)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "SRF Antibody (OAAL00313)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "SRF Antibody (OAAL00313)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "SRF"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "SRF"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "SRF"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "SRF"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "SRF"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "SRF"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.