Search Antibody, Protein, and ELISA Kit Solutions

SRF Antibody - N-terminal region (P100866_T100)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

P100866_T100-FITC Conjugated

P100866_T100-HRP Conjugated

P100866_T100-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
Serum response factor (c-fos serum response element-binding transcription factor)
NCBI Gene Id:
Protein Name:
Serum response factor
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-13029 from Santa Cruz Biotechnology.
Description of Target:
SRF is a ubiquitous nuclear protein that stimulates both cell proliferation and differentiation. It is a member of the MADS (MCM1, Agamous, Deficiens, and SRF) box superfamily of transcription factors. This protein binds to the serum response element (SRE) in the promoter region of target genes. This protein regulates the activity of many immediate-early genes, for example c-fos, and thereby participates in cell cycle regulation, apoptosis, cell growth, and cell differentiation. This gene is the downstream target of many pathways; for example, the mitogen-activated protein kinase pathway (MAPK) that acts through the ternary complex factors (TCFs).
Protein Size (# AA):
Molecular Weight:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SRF.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SRF.
The immunogen is a synthetic peptide directed towards the N terminal region of human SRF
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-SRF (P100866_T100)
Peptide Sequence:
Synthetic peptide located within the following region: ATGGYGPVSGAVSGAKPGKKTRGRVKIKMEFIDNKLRRYTTFSKRKTGIM
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-SRF (P100866_T100) antibody is Catalog # AAP31232 (Previous Catalog # AAPP01977)
Printable datasheet for anti-SRF (P100866_T100) antibody
Sample Type Confirmation:

SRF is supported by BioGPS gene expression data to be expressed in Jurkat

Target Reference:
Doi,H., et al., (2005) Arterioscler. Thromb. Vasc. Biol. 25 (11), 2328-2334

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...