Size:100 ul
Special Price $229.00 Regular Price $249.00
In Stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

P100866_T100-FITC Conjugated

P100866_T100-HRP Conjugated

P100866_T100-Biotin Conjugated

SRF Antibody - N-terminal region (P100866_T100)

Catalog#: P100866_T100
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application CHIP, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-13029 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human SRF
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data Anti-SRF (P100866_T100)
Peptide Sequence Synthetic peptide located within the following region: ATGGYGPVSGAVSGAKPGKKTRGRVKIKMEFIDNKLRRYTTFSKRKTGIM
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-SRF (P100866_T100) antibody is Catalog # AAP31232 (Previous Catalog # AAPP01977)
Datasheets/Manuals Printable datasheet for anti-SRF (P100866_T100) antibody
Sample Type Confirmation

SRF is supported by BioGPS gene expression data to be expressed in Jurkat

Target Reference Doi,H., et al., (2005) Arterioscler. Thromb. Vasc. Biol. 25 (11), 2328-2334
Gene Symbol SRF
Official Gene Full Name Serum response factor (c-fos serum response element-binding transcription factor)
Alias Symbols MCM1
NCBI Gene Id 6722
Protein Name Serum response factor
Description of Target SRF is a ubiquitous nuclear protein that stimulates both cell proliferation and differentiation. It is a member of the MADS (MCM1, Agamous, Deficiens, and SRF) box superfamily of transcription factors. This protein binds to the serum response element (SRE) in the promoter region of target genes. This protein regulates the activity of many immediate-early genes, for example c-fos, and thereby participates in cell cycle regulation, apoptosis, cell growth, and cell differentiation. This gene is the downstream target of many pathways; for example, the mitogen-activated protein kinase pathway (MAPK) that acts through the ternary complex factors (TCFs).
Swissprot Id P11831
Protein Accession # NP_003122
Nucleotide Accession # NM_003131
Protein Size (# AA) 508
Molecular Weight 52kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express SRF.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express SRF.
  1. What is the species homology for "SRF Antibody - N-terminal region (P100866_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Human, Mouse, Pig, Rabbit, Rat, Zebrafish".

  2. How long will it take to receive "SRF Antibody - N-terminal region (P100866_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "SRF Antibody - N-terminal region (P100866_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "SRF Antibody - N-terminal region (P100866_T100)"?

    This target may also be called "MCM1" in publications.

  5. What is the shipping cost for "SRF Antibody - N-terminal region (P100866_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "SRF Antibody - N-terminal region (P100866_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "SRF Antibody - N-terminal region (P100866_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "52kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "SRF Antibody - N-terminal region (P100866_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "SRF"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "SRF"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "SRF"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "SRF"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "SRF"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "SRF"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:SRF Antibody - N-terminal region (P100866_T100)
Your Rating
We found other products you might like!