Size:100 ul
In Stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP34171_P050 Unconjugated

ARP34171_P050-HRP Conjugated

ARP34171_P050-Biotin Conjugated

SMARCB1 Antibody - N-terminal region : FITC (ARP34171_P050-FITC)

Catalog#: ARP34171_P050-FITC
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC (FAM): Excitation 495 nm/ Emission 520 nm
ApplicationIHC, WB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Replacement ItemThis antibody may replace item sc-13055 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human SMARCB1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Complete computational species homology dataAnti-SMARCB1 (ARP34171_P050)
Peptide SequenceSynthetic peptide located within the following region: RGSLYKRYPSLWRRLATVEERKKIVASSHGKKTKPNTKDHGYTTLATSVT
Concentration0.5 mg/ml
Blocking PeptideFor anti-SMARCB1 (ARP34171_P050-FITC) antibody is Catalog # AAPP05433
Datasheets/ManualsPrintable datasheet for anti-SMARCB1 (ARP34171_P050-FITC) antibody
Target ReferenceMueller,W., et al., (2004) Neuropathol Appl Neurobiol 30 (3), 304-307
Gene SymbolSMARCB1
Official Gene Full NameSWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1
Alias SymbolsRDT, INI1, SNF5, Snr1, BAF47, RTPS1, Sfh1p, hSNFS, SNF5L1
NCBI Gene Id6598
Protein NameSWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1
Description of TargetThe protein encoded by SMARCB1 is part of a complex that relieves repressive chromatin structures, allowing the transcriptional machinery to access its targets more effectively. The encoded nuclear protein may also bind to and enhance the DNA joining activity of HIV-1 integrase. SMARCB1 has been found to be a tumor suppressor, and mutations in it have been associated with malignant rhabdoid tumors.
Swissprot IdQ12824
Protein Accession #NP_003064
Nucleotide Accession #NM_003073
Protein Size (# AA)385
Molecular Weight44kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express SMARCB1.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express SMARCB1.
  1. What is the species homology for "SMARCB1 Antibody - N-terminal region : FITC (ARP34171_P050-FITC)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat".

  2. How long will it take to receive "SMARCB1 Antibody - N-terminal region : FITC (ARP34171_P050-FITC)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "SMARCB1 Antibody - N-terminal region : FITC (ARP34171_P050-FITC)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact

  4. What are other names for "SMARCB1 Antibody - N-terminal region : FITC (ARP34171_P050-FITC)"?

    This target may also be called "RDT, INI1, SNF5, Snr1, BAF47, RTPS1, Sfh1p, hSNFS, SNF5L1" in publications.

  5. What is the shipping cost for "SMARCB1 Antibody - N-terminal region : FITC (ARP34171_P050-FITC)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "SMARCB1 Antibody - N-terminal region : FITC (ARP34171_P050-FITC)"?

    All Aviva products have been through vigorous validations and carry 100% satisfaction warranty.

  7. Can I get bulk pricing for "SMARCB1 Antibody - N-terminal region : FITC (ARP34171_P050-FITC)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "44kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "SMARCB1 Antibody - N-terminal region : FITC (ARP34171_P050-FITC)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "SMARCB1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "SMARCB1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "SMARCB1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "SMARCB1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "SMARCB1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "SMARCB1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:SMARCB1 Antibody - N-terminal region : FITC (ARP34171_P050-FITC)
Your Rating
Aviva Validation Data
Aviva ChIP Antibodies
Free Microscope
Aviva Travel Grant