Size:100 ul
$319.00
In stock
SKU
ARP34171_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP34171_P050-FITC Conjugated

ARP34171_P050-HRP Conjugated

ARP34171_P050-Biotin Conjugated

SMARCB1 Antibody - N-terminal region (ARP34171_P050)

Catalog#: ARP34171_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-13055 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human SMARCB1
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Complete computational species homology data Anti-SMARCB1 (ARP34171_P050)
Peptide Sequence Synthetic peptide located within the following region: RGSLYKRYPSLWRRLATVEERKKIVASSHGKKTKPNTKDHGYTTLATSVT
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-SMARCB1 (ARP34171_P050) antibody is Catalog # AAPP05433
Datasheets/Manuals Printable datasheet for anti-SMARCB1 (ARP34171_P050) antibody
Target Reference Mueller,W., et al., (2004) Neuropathol Appl Neurobiol 30 (3), 304-307
Gene Symbol SMARCB1
Official Gene Full Name SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1
Alias Symbols RDT, INI1, SNF5, Snr1, BAF47, RTPS1, Sfh1p, hSNFS, SNF5L1
NCBI Gene Id 6598
Protein Name SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1
Description of Target The protein encoded by SMARCB1 is part of a complex that relieves repressive chromatin structures, allowing the transcriptional machinery to access its targets more effectively. The encoded nuclear protein may also bind to and enhance the DNA joining activity of HIV-1 integrase. SMARCB1 has been found to be a tumor suppressor, and mutations in it have been associated with malignant rhabdoid tumors.
Swissprot Id Q12824
Protein Accession # NP_003064
Nucleotide Accession # NM_003073
Protein Size (# AA) 385
Molecular Weight 44kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express SMARCB1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express SMARCB1.
Protein Interactions UBC; SOX2; tat; EPAS1; TRA2A; NCSTN; SAP18; EIF4A3; ARID1A; DPF1; VTN; TOP2B; SON; SMARCE1; SMARCD3; SMARCD2; SMARCD1; SMARCC2; SMARCA4; SMARCA2; SMARCC1; ARID1B; HDAC2; APP; PHF10; UBD; COPS5; CUL3; TFAP4; CAND1; RB1CC1; UBB; CEBPB; UL114; UL44; CHFR; DP
Write Your Own Review
You're reviewing:SMARCB1 Antibody - N-terminal region (ARP34171_P050)
Your Rating