Size:100 ul
$319.00
In stock
SKU
ARP34171_P050-HRP
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP34171_P050 Unconjugated

ARP34171_P050-FITC Conjugated

ARP34171_P050-Biotin Conjugated

SMARCB1 Antibody - N-terminal region : HRP (ARP34171_P050-HRP)

Catalog#: ARP34171_P050-HRP
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Product Format Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Clonality Polyclonal
Host Rabbit
Conjugation HRP
Application IHC, WB
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Replacement Item This antibody may replace item sc-13055 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human SMARCB1
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Complete computational species homology data Anti-SMARCB1 (ARP34171_P050)
Peptide Sequence Synthetic peptide located within the following region: RGSLYKRYPSLWRRLATVEERKKIVASSHGKKTKPNTKDHGYTTLATSVT
Concentration 0.5 mg/ml
Blocking Peptide For anti-SMARCB1 (ARP34171_P050-HRP) antibody is Catalog # AAPP05433
Datasheets/Manuals Printable datasheet for anti-SMARCB1 (ARP34171_P050-HRP) antibody
Target Reference Mueller,W., et al., (2004) Neuropathol Appl Neurobiol 30 (3), 304-307
Gene Symbol SMARCB1
Official Gene Full Name SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1
Alias Symbols RDT, INI1, SNF5, Snr1, BAF47, RTPS1, Sfh1p, hSNFS, SNF5L1
NCBI Gene Id 6598
Protein Name SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1
Description of Target The protein encoded by SMARCB1 is part of a complex that relieves repressive chromatin structures, allowing the transcriptional machinery to access its targets more effectively. The encoded nuclear protein may also bind to and enhance the DNA joining activity of HIV-1 integrase. SMARCB1 has been found to be a tumor suppressor, and mutations in it have been associated with malignant rhabdoid tumors.
Swissprot Id Q12824
Protein Accession # NP_003064
Nucleotide Accession # NM_003073
Protein Size (# AA) 385
Molecular Weight 44kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express SMARCB1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express SMARCB1.
Protein Interactions UBC; SOX2; tat; EPAS1; TRA2A; NCSTN; SAP18; EIF4A3; ARID1A; DPF1; VTN; TOP2B; SON; SMARCE1; SMARCD3; SMARCD2; SMARCD1; SMARCC2; SMARCA4; SMARCA2; SMARCC1; ARID1B; HDAC2; APP; PHF10; UBD; COPS5; CUL3; TFAP4; CAND1; RB1CC1; UBB; CEBPB; UL114; UL44; CHFR; DP
Write Your Own Review
You're reviewing:SMARCB1 Antibody - N-terminal region : HRP (ARP34171_P050-HRP)
Your Rating