Aviva Systems Biology office will be closed for Memorial Day - May 27, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

SMARCB1 Antibody - middle region (ARP34172_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP34172_P050-FITC Conjugated

ARP34172_P050-HRP Conjugated

ARP34172_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1
NCBI Gene Id:
Protein Name:
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
RDT, CSS3, INI1, SNF5, Snr1, BAF47, MRD15, RTPS1, Sfh1p, hSNFS, SNF5L1, SWNTS1, PPP1R144
Replacement Item:
This antibody may replace item sc-13055 from Santa Cruz Biotechnology.
Description of Target:
The protein encoded by this gene is part of a complex that relieves repressive chromatin structures, allowing the transcriptional machinery to access its targets more effectively. The encoded nuclear protein may also bind to and enhance the DNA joining activity of HIV-1 integrase. This gene has been found to be a tumor suppressor, and mutations in it have been associated with malignant rhabdoid tumors. Alternatively spliced transcript variants have been found for this gene.
Protein Size (# AA):
Molecular Weight:
41 kDa
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SMARCB1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SMARCB1.
The immunogen is a synthetic peptide directed towards the middle region of human SMARCB1
Predicted Species Reactivity:
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Complete computational species homology data:
Anti-SMARCB1 (ARP34172_P050)
Peptide Sequence:
Synthetic peptide located within the following region: PLTFVPAIASAIRQQIESYPTDSILEDQSDQRVIIKLNIHVGNISLVDQF
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-SMARCB1 (ARP34172_P050) antibody is Catalog # AAP34172
Printable datasheet for anti-SMARCB1 (ARP34172_P050) antibody
Sample Type Confirmation:

SMARCB1 is supported by BioGPS gene expression data to be expressed in Jurkat

Target Reference:
Kimura,K., et al., (2006) Genome Res. 16 (1), 55-65

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...