SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP32389_P050
Price: $0.00
SKU
ARP32389_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-SIRT3 (ARP32389_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human SIRT3
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 79%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 86%; Rabbit: 100%; Rat: 79%
Peptide SequenceSynthetic peptide located within the following region: VGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKLDGP
Concentration0.5 mg/ml
Blocking PeptideFor anti-SIRT3 (ARP32389_P050) antibody is Catalog # AAP32389 (Previous Catalog # AAPP03379)
ReferenceOnyango,P., et al., (2002) Proc. Natl. Acad. Sci. U.S.A. 15 99(21), 13653-8
Publications

Dong, R. et al. Cells with dendritic cell morphology and immunophenotype, binuclear morphology, and immunosuppressive function in dendritic cell cultures. Cell. Immunol. 272, 1-10 (2011). 22087287

Dysfunctional MnSOD leads to redox dysregulation and activation of prosurvival AKT signaling in uterine leiomyomas. Sci Adv. 2, e1601132 (2016). 27847869

Lanza, I. R. et al. Endurance exercise as a countermeasure for aging. Diabetes 57, 2933-42 (2008). 18716044

Gene SymbolSIRT3
Gene Full NameSirtuin 3
Alias SymbolsSIR2L3
NCBI Gene Id23410
Protein NameNAD-dependent protein deacetylase sirtuin-3, mitochondrial
Description of TargetThe SIRT3 gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. SIRT3 encodes a protein that is included in class I of the sirtuin family.
Uniprot IDQ9NTG7
Protein Accession #NP_001017524
Nucleotide Accession #NM_001017524
Protein Size (# AA)257
Molecular Weight28kDa
Protein InteractionsSIRT5; SKP2; UBC; HSPD1; CMYA5; PGAP1; RIF1; NCAPD2; HERC2; TTF2; UQCRH; UGDH; HSP90B1; SNTB1; SBF1; HSPA9; HSPA5; HSPA4; HSPA1L; GRN; ATP5B; ATP5A1; SIRT4; tat; XRCC6; FOXO3; DNM1L; PEX5;
  1. What is the species homology for "SIRT3 Antibody - C-terminal region (ARP32389_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "SIRT3 Antibody - C-terminal region (ARP32389_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "SIRT3 Antibody - C-terminal region (ARP32389_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "SIRT3 Antibody - C-terminal region (ARP32389_P050)"?

    This target may also be called "SIR2L3" in publications.

  5. What is the shipping cost for "SIRT3 Antibody - C-terminal region (ARP32389_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "SIRT3 Antibody - C-terminal region (ARP32389_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "SIRT3 Antibody - C-terminal region (ARP32389_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "28kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "SIRT3 Antibody - C-terminal region (ARP32389_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "SIRT3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "SIRT3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "SIRT3"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "SIRT3"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "SIRT3"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "SIRT3"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:SIRT3 Antibody - C-terminal region (ARP32389_P050)
Your Rating
We found other products you might like!