SIRT3 Antibody - middle region (ARP32388_T100)

Catalog No: ARP32388_T100

WB Suggested Anti-SIRT3 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SIRT3
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Dog: 100%; Guinea Pig: 83%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 92%; Rat: 100%; Yeast: 77%; Zebrafish: 85%
• Peptide Sequence: Synthetic peptide located within the following region: SGIPDFRSPGSGLYSNLQQYDLPYPEAIFELPFFFHNPKPFFTLAKELYP
• Concentration: 1.0 mg/ml
• Blocking Peptide: For anti-SIRT3 (ARP32388_T100) antibody is Catalog # AAP32388 (Previous Catalog # AAPP03378)
• Reference: Bellizzi,D., et al., (2005) Genomics 85 (2), 258-263

Target Info

• Gene Symbol: SIRT3
• Gene Full Name: Sirtuin 3
• Alias Symbols: SIR2L3
• NCBI Gene Id: 23410
• Protein Name: NAD-dependent protein deacetylase sirtuin-3, mitochondrial
• Description of Target: SIRT3 is a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class I of the sirtuin family.
• Uniprot ID: Q9NTG7
• Protein Accession #: NP_036371
• Nucleotide Accession #: NM_012239
• Protein Size (# AA): 399
• Molecular Weight: 44kDa
• Protein Interactions: SIRT5; SKP2; UBC; HSPD1; CMYA5; PGAP1; RIF1; NCAPD2; HERC2; TTF2; UQCRH; UGDH; HSP90B1; SNTB1; SBF1; HSPA9; HSPA5; HSPA4; HSPA1L; GRN; ATP5B; ATP5A1; SIRT4; tat; XRCC6; FOXO3; DNM1L; PEX5;