- Gene Symbol:
- CMC4
- NCBI Gene Id:
- 100272147
- Official Gene Full Name:
- Mature T-cell proliferation 1 neighbor
- Protein Name:
- Cx9C motif-containing protein 4
- Swissprot Id:
- P56277
- Protein Accession #:
- NP_001018024
- Nucleotide Accession #:
- NM_001018024
- Alias Symbols:
- C6.1B, MGC2069, MTCP1, p8, p8MTCP1, MTCP1NB
- Description of Target:
- This gene was identified by involvement in some t(X;14) translocations associated with mature T-cell proliferations. This region has a complex gene structure, with a common promoter and 5' exon spliced to two different sets of 3' exons that encode two different proteins. This gene represents the downstream 8 kDa protein that localizes to mitochondria.
- Protein Size (# AA):
- 68
- Molecular Weight:
- 8kDa
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Purification:
- Affinity Purified
- Application:
- IHC, WB
- Tissue Tool:
- Find tissues and cell lines supported by DNA array analysis to express MTCP1NB.
- RNA Seq:
- Find tissues and cell lines supported by RNA-seq analysis to express MTCP1NB.
- Tested Species Reactivity:
- Human
- Predicted Homology Based on Immunogen Sequence:
- Cow: 91%; Dog: 92%; Guinea Pig: 91%; Horse: 91%; Human: 100%; Mouse: 91%; Rabbit: 93%; Rat: 92%
- Complete computational species homology data:
- Anti-MTCP1NB (ARP30860_P050)
- Peptide Sequence:
- Synthetic peptide located within the following region: KCLQANSYMESKCQAVIQELRKCCAQYPKGRSVVCSGFEKEEEENLTRKS
- Product Format:
- Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
- Reconstitution and Storage:
- For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
- Concentration:
- Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
- Blocking Peptide:
- For anti-CMC4 (ARP30860_P050) antibody is Catalog # AAP30860
- Datasheets/Manuals:
- Printable datasheet for anti-CMC4 (ARP30860_P050) antibody
- Sample Type Confirmation:
CMC4 is strongly supported by BioGPS gene expression data to be expressed in HEK293T
Product Reviews
- Protocol:
- Tips Information:
See our General FAQ page.
