MTCP1NB Antibody - N-terminal region (ARP30860_P050)

Catalog#: ARP30860_P050

• Size: 100 ul

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 91%; Dog: 92%; Guinea Pig: 91%; Horse: 91%; Human: 100%; Mouse: 91%; Rabbit: 93%; Rat: 92%
• Peptide Sequence: Synthetic peptide located within the following region: KCLQANSYMESKCQAVIQELRKCCAQYPKGRSVVCSGFEKEEEENLTRKS
• Concentration: Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
• Blocking Peptide: For anti-CMC4 (ARP30860_P050) antibody is Catalog # AAP30860
• Sample Type Confirmation:

  CMC4 is strongly supported by BioGPS gene expression data to be expressed in HEK293T

• Gene Symbol: CMC4
• Official Gene Full Name: Mature T-cell proliferation 1 neighbor
• Alias Symbols: C6.1B, MGC2069, MTCP1, p8, p8MTCP1, MTCP1NB
• NCBI Gene Id: 100272147
• Protein Name: Cx9C motif-containing protein 4
• Description of Target: This gene was identified by involvement in some t(X;14) translocations associated with mature T-cell proliferations. This region has a complex gene structure, with a common promoter and 5' exon spliced to two different sets of 3' exons that encode two different proteins. This gene represents the downstream 8 kDa protein that localizes to mitochondria.
• Swissprot Id: P56277
• Protein Accession #: NP_001018024
• Nucleotide Accession #: NM_001018024
• Protein Size (# AA): 68
• Molecular Weight: 8kDa
• RNA Seq: Find tissues and cell lines supported by RNA-seq analysis to express MTCP1NB.

Protocol:

• Reconstitution Instructions
• Immunohistochemistry (IHC) Protocol
• Immunocytochemistry (ICC) Protocol
• Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
• Western Blotting/Immunoblotting (WB/IB) Protocol
• Blocking Peptide Competition Protocol (BPCP)
• Immunoprecipitation (IP) Protocol

Tips Information:

• IHC Tips & Tricks
• ICC Tips & Tricks
• ELISA Tips & Tricks
• WB/IB Tips & Tricks
• IP Tips & Tricks

See our General FAQ page.

Product Protocols: MTCP1NB antibody tested by IHC with human adult liver (ARP30860_P050)