Search Antibody, Protein, and ELISA Kit Solutions

MTCP1NB antibody - N-terminal region (ARP30860_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP30860_P050-FITC Conjugated

ARP30860_P050-HRP Conjugated

ARP30860_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Mature T-cell proliferation 1 neighbor
Protein Name:
Cx9C motif-containing protein 4
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
C6.1B, MGC2069, MTCP1, p8, p8MTCP1, MTCP1NB
Description of Target:
This gene was identified by involvement in some t(X;14) translocations associated with mature T-cell proliferations. This region has a complex gene structure, with a common promoter and 5' exon spliced to two different sets of 3' exons that encode two different proteins. This gene represents the downstream 8 kDa protein that localizes to mitochondria.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MTCP1NB.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MTCP1NB.
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 91%; Dog: 92%; Guinea Pig: 91%; Horse: 91%; Human: 100%; Mouse: 91%; Rabbit: 93%; Rat: 92%
Complete computational species homology data:
Anti-MTCP1NB (ARP30860_P050)
Peptide Sequence:
Synthetic peptide located within the following region: KCLQANSYMESKCQAVIQELRKCCAQYPKGRSVVCSGFEKEEEENLTRKS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-CMC4 (ARP30860_P050) antibody is Catalog # AAP30860
Printable datasheet for anti-CMC4 (ARP30860_P050) antibody
Sample Type Confirmation:

CMC4 is strongly supported by BioGPS gene expression data to be expressed in HEK293T

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...