SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP30860_P050-FITC
Size:100ul
Price: $434.00
SKU
ARP30860_P050-FITC
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

MTCP1NB Antibody - N-terminal region : FITC (ARP30860_P050-FITC)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-CMC4 (ARP30860_P050-FITC) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationFITC: Fluorescein Isothiocyanate
ApplicationIHC, WB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 91%; Dog: 92%; Guinea Pig: 91%; Horse: 91%; Human: 100%; Mouse: 91%; Rabbit: 93%; Rat: 92%
Peptide SequenceSynthetic peptide located within the following region: KCLQANSYMESKCQAVIQELRKCCAQYPKGRSVVCSGFEKEEEENLTRKS
Concentration0.5 mg/ml
Blocking PeptideFor anti-CMC4 (ARP30860_P050-FITC) antibody is Catalog # AAP30860
Sample Type Confirmation

CMC4 is strongly supported by BioGPS gene expression data to be expressed in HEK293T

Gene SymbolCMC4
Gene Full NameMature T-cell proliferation 1 neighbor
Alias Symbolsp8, C6.1B, MTCP1, MTCP1B, MTCP1NB, p8MTCP1
NCBI Gene Id100272147
Protein NameCx9C motif-containing protein 4
Description of TargetThis gene was identified by involvement in some t(X;14) translocations associated with mature T-cell proliferations. This region has a complex gene structure, with a common promoter and 5' exon spliced to two different sets of 3' exons that encode two different proteins. This gene represents the downstream 8 kDa protein that localizes to mitochondria.
Uniprot IDP56277
Protein Accession #NP_001018024
Nucleotide Accession #NM_001018024
Protein Size (# AA)68
Molecular Weight8kDa
  1. What is the species homology for "MTCP1NB Antibody - N-terminal region : FITC (ARP30860_P050-FITC)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "MTCP1NB Antibody - N-terminal region : FITC (ARP30860_P050-FITC)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "MTCP1NB Antibody - N-terminal region : FITC (ARP30860_P050-FITC)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "MTCP1NB Antibody - N-terminal region : FITC (ARP30860_P050-FITC)"?

    This target may also be called "p8, C6.1B, MTCP1, MTCP1B, MTCP1NB, p8MTCP1" in publications.

  5. What is the shipping cost for "MTCP1NB Antibody - N-terminal region : FITC (ARP30860_P050-FITC)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "MTCP1NB Antibody - N-terminal region : FITC (ARP30860_P050-FITC)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "MTCP1NB Antibody - N-terminal region : FITC (ARP30860_P050-FITC)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "8kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "MTCP1NB Antibody - N-terminal region : FITC (ARP30860_P050-FITC)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CMC4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CMC4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CMC4"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CMC4"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CMC4"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CMC4"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:MTCP1NB Antibody - N-terminal region : FITC (ARP30860_P050-FITC)
Your Rating
We found other products you might like!