MTCP1NB Peptide - N-terminal region (AAP30860)

Data Sheet
 
Sku AAP30860
Price $99.00
Name MTCP1NB Peptide - N-terminal region (AAP30860)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene CMC4
Alias symbols C6.1B, MGC2069, MTCP1, p8, p8MTCP1, MTCP1NB
Gene id 100272147
Description of target This gene was identified by involvement in some t(X;14) translocations associated with mature T-cell proliferations. This region has a complex gene structure, with a common promoter and 5' exon spliced to two different sets of 3' exons that encode two different proteins. This gene represents the downstream 8 kDa protein that localizes to mitochondria.
Swissprot id P56277
Protein accession num NP_001018024
Nucleotide accession num NM_001018024
Protein size 68 amino acids
Molecular weight 8kDa
Species reactivity Human
Application IHC, WB
Peptide sequence KCLQANSYMESKCQAVIQELRKCCAQYPKGRSVVCSGFEKEEEENLTRKS
Quality control The peptide is characterized by mass spectroscopy
Key reference N/A
Description This is a synthetic peptide designed for use in combination with anti-MTCP1NB Antibody (ARP30860_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery  International: 3-5 business days
Protocol
Tips

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com