| Product Number |
ARP30860_P050 |
| Product Page |
www.avivasysbio.com/mtcp1nb-antibody-n-terminal-region-arp30860-p050.html |
| Name |
MTCP1NB Antibody - N-terminal region (ARP30860_P050) |
| Protein Size (# AA) |
68 amino acids |
| Molecular Weight |
8kDa |
| NCBI Gene Id |
100272147 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Mature T-cell proliferation 1 neighbor |
| Alias Symbols |
p8, C6.1B, MTCP1, MTCP1B, MTCP1NB, p8MTCP1 |
| Peptide Sequence |
Synthetic peptide located within the following region: KCLQANSYMESKCQAVIQELRKCCAQYPKGRSVVCSGFEKEEEENLTRKS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
This gene was identified by involvement in some t(X;14) translocations associated with mature T-cell proliferations. This region has a complex gene structure, with a common promoter and 5' exon spliced to two different sets of 3' exons that encode two different proteins. This gene represents the downstream 8 kDa protein that localizes to mitochondria. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-CMC4 (ARP30860_P050) antibody |
| Blocking Peptide |
For anti-CMC4 (ARP30860_P050) antibody is Catalog # AAP30860 |
| Uniprot ID |
P56277 |
| Protein Name |
Cx9C motif-containing protein 4 |
| Sample Type Confirmation |
CMC4 is strongly supported by BioGPS gene expression data to be expressed in HEK293T |
| Protein Accession # |
NP_001018024 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001018024 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
CMC4 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 91%; Dog: 92%; Guinea Pig: 91%; Horse: 91%; Human: 100%; Mouse: 91%; Rabbit: 93%; Rat: 92% |
| Image 1 | Human Adult Liver
 | Rabbit Anti-MTCP1NB Antibody
Catalog Number: ARP30860_P050
Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver
Observed Staining: Cytoplasm in hepatocytes, strong signal resembling mitochondria staining, wide tissue distribution
Primary Antibody Concentration: 1:100
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 â 2.0 sec
Protocol located in Reviews and Data. |
|
| Image 2 | Human HEK293T
 | WB Suggested Anti-MTCP1NB Antibody
Titration: 1.0 ug/ml
Positive Control: 293T Whole CellCMC4 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells |
|
