- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
MTCP1NB Antibody - N-terminal region : Biotin (ARP30860_P050-Biotin)
| Datasheets/Manuals | Printable datasheet for anti-CMC4 (ARP30860_P050-Biotin) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | Biotin |
| Application | IHC, WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 91%; Dog: 92%; Guinea Pig: 91%; Horse: 91%; Human: 100%; Mouse: 91%; Rabbit: 93%; Rat: 92% |
| Peptide Sequence | Synthetic peptide located within the following region: KCLQANSYMESKCQAVIQELRKCCAQYPKGRSVVCSGFEKEEEENLTRKS |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-CMC4 (ARP30860_P050-Biotin) antibody is Catalog # AAP30860 |
| Sample Type Confirmation | CMC4 is strongly supported by BioGPS gene expression data to be expressed in HEK293T |
| Gene Symbol | CMC4 |
|---|---|
| Gene Full Name | Mature T-cell proliferation 1 neighbor |
| Alias Symbols | p8, C6.1B, MTCP1, MTCP1B, MTCP1NB, p8MTCP1 |
| NCBI Gene Id | 100272147 |
| Protein Name | Cx9C motif-containing protein 4 |
| Description of Target | This gene was identified by involvement in some t(X;14) translocations associated with mature T-cell proliferations. This region has a complex gene structure, with a common promoter and 5' exon spliced to two different sets of 3' exons that encode two different proteins. This gene represents the downstream 8 kDa protein that localizes to mitochondria. |
| Uniprot ID | P56277 |
| Protein Accession # | NP_001018024 |
| Nucleotide Accession # | NM_001018024 |
| Protein Size (# AA) | 68 |
| Molecular Weight | 8kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "MTCP1NB Antibody - N-terminal region : Biotin (ARP30860_P050-Biotin)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit".
-
How long will it take to receive "MTCP1NB Antibody - N-terminal region : Biotin (ARP30860_P050-Biotin)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "MTCP1NB Antibody - N-terminal region : Biotin (ARP30860_P050-Biotin)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "MTCP1NB Antibody - N-terminal region : Biotin (ARP30860_P050-Biotin)"?
This target may also be called "p8, C6.1B, MTCP1, MTCP1B, MTCP1NB, p8MTCP1" in publications.
-
What is the shipping cost for "MTCP1NB Antibody - N-terminal region : Biotin (ARP30860_P050-Biotin)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "MTCP1NB Antibody - N-terminal region : Biotin (ARP30860_P050-Biotin)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "MTCP1NB Antibody - N-terminal region : Biotin (ARP30860_P050-Biotin)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "8kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "MTCP1NB Antibody - N-terminal region : Biotin (ARP30860_P050-Biotin)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "CMC4"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "CMC4"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "CMC4"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "CMC4"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "CMC4"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "CMC4"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.
