MESP2 Antibody (OAAL00925)

Catalog No: OAAL00925

Size:100UG

Immunofluorescence of monoclonal antibody to MESP2 on HeLa cell. [antibody concentration 10 ug/ml]

Product Info

• Predicted Species Reactivity: Human, Mouse
• Product Format: Liquid. In 1x PBS, pH 7.4
• Clonality: Monoclonal
• Clone: 1C8
• Isotype: IgG2a Kappa
• Host: Mouse
• Application: Enzyme-linked immunosorbent assay|Immunofluorescence
• Reconstitution and Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Immunogen: MESP2 (XP_085261, 2 a.a. ~ 125 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Peptide Sequence: AQSPPPQSLLGHDHWIFAQGWGWAGHWDSTSPASSSDSSGSCPCDGARGLPQPQPPSCSSRAAEAAATTPRRARTGPAGGQRQSASEREKLRMRTLARALHELRRFLPPSLAPAGQSLTKIETL
• Concentration: 1 mg/ml
• Tag: GST tag

Target Info

• Gene Symbol: MESP2
• Gene Full Name: mesoderm posterior bHLH transcription factor 2
• Alias Symbols: bHLHc6;class C basic helix-loop-helix protein 6;mesoderm posterior 2 homolog;mesoderm posterior basic helix-loop-helix transcription factor 2;mesoderm posterior protein 2;SCDO2.
• NCBI Gene Id: 145873
• Protein Name: PREDICTED: Homo sapiens mesoderm posterior 2 homolog (mouse) (MESP2), mRNA|PREDICTED: similar to mesoderm posterior 2 [Homo sapiens]
• Description of Target: This gene encodes a member of the bHLH family of transcription factors and plays a key role in defining the rostrocaudal patterning of somites via interactions with multiple Notch signaling pathways. This gene is expressed in the anterior presomitic mesoderm and is downregulated immediately after the formation of segmented somites. This gene also plays a role in the formation of epithelial somitic mesoderm and cardiac mesoderm. Mutations in the MESP2 gene cause autosomal recessive spondylocostal dystosis 2 (SCD02).
• Protein Accession #: https://www.ncbi.nlm.nih.gov/protein/XP_085261
• Nucleotide Accession #: https://www.ncbi.nlm.nih.gov/nuccore/XM_085261
• Molecular Weight: 26 kDa