Search Antibody, Protein, and ELISA Kit Solutions

KRT7 antibody - N-terminal region (ARP58232_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP58232_P050-FITC Conjugated

ARP58232_P050-HRP Conjugated

ARP58232_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Keratin 7
Protein Name:
Keratin, type II cytoskeletal 7
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
CK7, K2C7, K7, MGC129731, MGC3625, SCL
Replacement Item:
This antibody may replace item sc-17116 from Santa Cruz Biotechnology.
Description of Target:
KRT7 is a member of the keratin protein family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. This type II cytokeratin is specifically expressed in the simple epithelia lining the cavities of the internal organs and in the gland ducts and blood vessels. The genes encoding the type II cytokeratins are clustered in a region of chromosome 12q12-q13. The protein encoded by this gene is a member of the keratin gene family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. This type II cytokeratin is specifically expressed in the simple epithelia lining the cavities of the internal organs and in the gland ducts and blood vessels. The genes encoding the type II cytokeratins are clustered in a region of chromosome 12q12-q13. Alternative splicing may result in several transcript variants; however, not all variants have been fully described. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express KRT7.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express KRT7.
The immunogen is a synthetic peptide directed towards the N terminal region of human KRT7
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 79%; Dog: 79%; Horse: 86%; Human: 100%
Complete computational species homology data:
Anti-KRT7 (ARP58232_P050)
Peptide Sequence:
Synthetic peptide located within the following region: SIHFSSPVFTSRSAAFSGRGAQVRLSSARPGGLGSSSLYGLGASRPRVAV
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-KRT7 (ARP58232_P050) antibody is Catalog # AAP58232 (Previous Catalog # AAPP32831)
Printable datasheet for anti-KRT7 (ARP58232_P050) antibody
Target Reference:
Judson,K., (2008) Int. J. Gynecol. Pathol. 27 (2), 182-190

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...