Size:100 ul
$319.00
In stock
SKU
ARP58232_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP58232_P050-FITC Conjugated

ARP58232_P050-HRP Conjugated

ARP58232_P050-Biotin Conjugated

KRT7 Antibody - N-terminal region (ARP58232_P050)

Catalog#: ARP58232_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Horse, Human
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB, IHC
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-17116 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human KRT7
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 79%; Dog: 79%; Horse: 86%; Human: 100%
Complete computational species homology data Anti-KRT7 (ARP58232_P050)
Peptide Sequence Synthetic peptide located within the following region: SIHFSSPVFTSRSAAFSGRGAQVRLSSARPGGLGSSSLYGLGASRPRVAV
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-KRT7 (ARP58232_P050) antibody is Catalog # AAP58232 (Previous Catalog # AAPP32831)
Datasheets/Manuals Printable datasheet for anti-KRT7 (ARP58232_P050) antibody
Target Reference Judson,K., (2008) Int. J. Gynecol. Pathol. 27 (2), 182-190
Gene Symbol KRT7
Official Gene Full Name Keratin 7
Alias Symbols CK7, K2C7, K7, MGC129731, MGC3625, SCL
NCBI Gene Id 3855
Protein Name Keratin, type II cytoskeletal 7
Description of Target KRT7 is a member of the keratin protein family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. This type II cytokeratin is specifically expressed in the simple epithelia lining the cavities of the internal organs and in the gland ducts and blood vessels. The genes encoding the type II cytokeratins are clustered in a region of chromosome 12q12-q13. The protein encoded by this gene is a member of the keratin gene family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. This type II cytokeratin is specifically expressed in the simple epithelia lining the cavities of the internal organs and in the gland ducts and blood vessels. The genes encoding the type II cytokeratins are clustered in a region of chromosome 12q12-q13. Alternative splicing may result in several transcript variants; however, not all variants have been fully described. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot Id A5A6N0
Protein Accession # NP_005547
Nucleotide Accession # NM_005556
Protein Size (# AA) 469
Molecular Weight 52kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express KRT7.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express KRT7.
Protein Interactions UBC; COG7; COG3; KDM1A; AP3S1; ATF2; ERLIN2; DIDO1; PCNA; KRT27; ATF7IP; LAPTM5; KRT17; KRT13; HSPA1A; EGFR; GRB2; EIF3A;
Write Your Own Review
You're reviewing:KRT7 Antibody - N-terminal region (ARP58232_P050)
Your Rating