KRT7 Antibody - N-terminal region : HRP (ARP58232_P050-HRP)

Catalog No: ARP58232_P050-HRP

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Cow, Dog, Horse
• Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: HRP: Horseradish Peroxidase
• Application: WB, IHC
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human KRT7
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 79%; Dog: 79%; Horse: 86%; Human: 100%
• Peptide Sequence: Synthetic peptide located within the following region: SIHFSSPVFTSRSAAFSGRGAQVRLSSARPGGLGSSSLYGLGASRPRVAV
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-KRT7 (ARP58232_P050-HRP) antibody is Catalog # AAP58232 (Previous Catalog # AAPP32831)
• Reference: Judson,K., (2008) Int. J. Gynecol. Pathol. 27 (2), 182-190

Target Info

• Gene Symbol: KRT7
• Gene Full Name: Keratin 7
• Alias Symbols: K7, CK7, SCL, K2C7
• NCBI Gene Id: 3855
• Protein Name: Keratin, type II cytoskeletal 7
• Description of Target: KRT7 is a member of the keratin protein family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. This type II cytokeratin is specifically expressed in the simple epithelia lining the cavities of the internal organs and in the gland ducts and blood vessels. The genes encoding the type II cytokeratins are clustered in a region of chromosome 12q12-q13. The protein encoded by this gene is a member of the keratin gene family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. This type II cytokeratin is specifically expressed in the simple epithelia lining the cavities of the internal organs and in the gland ducts and blood vessels. The genes encoding the type II cytokeratins are clustered in a region of chromosome 12q12-q13. Alternative splicing may result in several transcript variants; however, not all variants have been fully described. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Uniprot ID: A5A6N0
• Protein Accession #: NP_005547
• Nucleotide Accession #: NM_005556
• Protein Size (# AA): 469
• Molecular Weight: 52kDa
• Protein Interactions: UBC; COG7; COG3; KDM1A; AP3S1; ATF2; ERLIN2; DIDO1; PCNA; KRT27; ATF7IP; LAPTM5; KRT17; KRT13; HSPA1A; EGFR; GRB2; EIF3A;