SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP58232_P050-Biotin
Size:100ul
Price: $434.00
SKU
ARP58232_P050-Biotin
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

KRT7 Antibody - N-terminal region : Biotin (ARP58232_P050-Biotin)

Datasheets/ManualsPrintable datasheet for anti-KRT7 (ARP58232_P050-Biotin) antibody
Product Info
Predicted Species ReactivityHuman, Cow, Dog, Horse
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationBiotin
ApplicationWB, IHC
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human KRT7
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 79%; Dog: 79%; Horse: 86%; Human: 100%
Peptide SequenceSynthetic peptide located within the following region: SIHFSSPVFTSRSAAFSGRGAQVRLSSARPGGLGSSSLYGLGASRPRVAV
Concentration0.5 mg/ml
Blocking PeptideFor anti-KRT7 (ARP58232_P050-Biotin) antibody is Catalog # AAP58232 (Previous Catalog # AAPP32831)
ReferenceJudson,K., (2008) Int. J. Gynecol. Pathol. 27 (2), 182-190
Gene SymbolKRT7
Gene Full NameKeratin 7
Alias SymbolsK7, CK7, SCL, K2C7
NCBI Gene Id3855
Protein NameKeratin, type II cytoskeletal 7
Description of TargetKRT7 is a member of the keratin protein family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. This type II cytokeratin is specifically expressed in the simple epithelia lining the cavities of the internal organs and in the gland ducts and blood vessels. The genes encoding the type II cytokeratins are clustered in a region of chromosome 12q12-q13. The protein encoded by this gene is a member of the keratin gene family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. This type II cytokeratin is specifically expressed in the simple epithelia lining the cavities of the internal organs and in the gland ducts and blood vessels. The genes encoding the type II cytokeratins are clustered in a region of chromosome 12q12-q13. Alternative splicing may result in several transcript variants; however, not all variants have been fully described. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDA5A6N0
Protein Accession #NP_005547
Nucleotide Accession #NM_005556
Protein Size (# AA)469
Molecular Weight52kDa
Protein InteractionsUBC; COG7; COG3; KDM1A; AP3S1; ATF2; ERLIN2; DIDO1; PCNA; KRT27; ATF7IP; LAPTM5; KRT17; KRT13; HSPA1A; EGFR; GRB2; EIF3A;
  1. What is the species homology for "KRT7 Antibody - N-terminal region : Biotin (ARP58232_P050-Biotin)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Cow, Dog, Horse".

  2. How long will it take to receive "KRT7 Antibody - N-terminal region : Biotin (ARP58232_P050-Biotin)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "KRT7 Antibody - N-terminal region : Biotin (ARP58232_P050-Biotin)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "KRT7 Antibody - N-terminal region : Biotin (ARP58232_P050-Biotin)"?

    This target may also be called "K7, CK7, SCL, K2C7" in publications.

  5. What is the shipping cost for "KRT7 Antibody - N-terminal region : Biotin (ARP58232_P050-Biotin)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "KRT7 Antibody - N-terminal region : Biotin (ARP58232_P050-Biotin)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "KRT7 Antibody - N-terminal region : Biotin (ARP58232_P050-Biotin)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "52kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "KRT7 Antibody - N-terminal region : Biotin (ARP58232_P050-Biotin)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "KRT7"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "KRT7"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "KRT7"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "KRT7"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "KRT7"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "KRT7"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:KRT7 Antibody - N-terminal region : Biotin (ARP58232_P050-Biotin)
Your Rating
We found other products you might like!