KRT7 Antibody - N-terminal region (ARP58232_P050)

• Product Number: ARP58232_P050
• Name: KRT7 Antibody - N-terminal region (ARP58232_P050)
• Protein Size (# AA): 469 amino acids
• Molecular Weight: 52kDa
• NCBI Gene Id: 3855
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Keratin 7
• Alias Symbols: K7, CK7, SCL, K2C7
• Peptide Sequence: Synthetic peptide located within the following region: SIHFSSPVFTSRSAAFSGRGAQVRLSSARPGGLGSSSLYGLGASRPRVAV
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Judson,K., (2008) Int. J. Gynecol. Pathol. 27 (2), 182-190
• Description of Target: KRT7 is a member of the keratin protein family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. This type II cytokeratin is specifically expressed in the simple epithelia lining the cavities of the internal organs and in the gland ducts and blood vessels. The genes encoding the type II cytokeratins are clustered in a region of chromosome 12q12-q13. The protein encoded by this gene is a member of the keratin gene family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. This type II cytokeratin is specifically expressed in the simple epithelia lining the cavities of the internal organs and in the gland ducts and blood vessels. The genes encoding the type II cytokeratins are clustered in a region of chromosome 12q12-q13. Alternative splicing may result in several transcript variants; however, not all variants have been fully described. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Protein Interactions: UBC; COG7; COG3; KDM1A; AP3S1; ATF2; ERLIN2; DIDO1; PCNA; KRT27; ATF7IP; LAPTM5; KRT17; KRT13; HSPA1A; EGFR; GRB2; EIF3A;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-KRT7 (ARP58232_P050) antibody is Catalog # AAP58232 (Previous Catalog # AAPP32831)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human KRT7
• Uniprot ID: A5A6N0
• Protein Name: Keratin, type II cytoskeletal 7
• Protein Accession #: NP_005547
• Purification: Affinity Purified
• Nucleotide Accession #: NM_005556
• Tested Species Reactivity: Human
• Gene Symbol: KRT7
• Predicted Species Reactivity: Human, Cow, Dog, Horse
• Application: WB, IHC
• Predicted Homology Based on Immunogen Sequence: Cow: 79%; Dog: 79%; Horse: 86%; Human: 100%
• Image 1: Human HepG2
  
  WB Suggested Anti-KRT7 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:1562500
  Positive Control: HepG2 cell lysate
• Image 2: Human Lung Tissue
  
  KRT7 antibody - N-terminal region (ARP58232_P050)
  Catalog Number: ARP58232_P050
  Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue
  Observed Staining: Membrane of Pneumocytes
  Primary Antibody Concentration: 1:100
  Other Working Concentrations: 1/600
  Secondary Antibody: Donkey anti-Rabbit-Cy3
  Secondary Antibody Concentration: 1:200
  Magnification: 20X
  Exposure Time: 0.5 - 2.0 sec
• Image 3: Human Bronchial Epithelial Tissue
  
  KRT7 antibody - N-terminal region (ARP58232_P050)
  Catalog Number: ARP58232_P050
  Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue
  Observed Staining: Cytoplasm and membrane of bronchial epithelial tissue
  Primary Antibody Concentration: 1:100
  Other Working Concentrations: 1/600
  Secondary Antibody: Donkey anti-Rabbit-Cy3
  Secondary Antibody Concentration: 1:200
  Magnification: 20X
  Exposure Time: 0.5 - 2.0 sec