SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP48070_P050
Price: $0.00
SKU
ARP48070_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-IFNLR1 (ARP48070_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Rat, Cow, Horse, Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human IL28RA
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 80%; Horse: 87%; Human: 100%; Pig: 92%; Rabbit: 86%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: QDVTYFVAYQSSPTRRRWREVEECAGTKELLCSMMCLKKQDLYNKFKGRV
Concentration0.5 mg/ml
Blocking PeptideFor anti-IFNLR1 (ARP48070_P050) antibody is Catalog # AAP48070 (Previous Catalog # AAPS21201)
Subunitalpha
ReferenceDumoutier,L., (2004) J. Biol. Chem. 279 (31), 32269-32274
Description
Gene SymbolIFNLR1
Gene Full NameInterleukin 28 receptor, alpha (interferon, lambda receptor)
Alias SymbolsIFNLR, LICR2, IL28RA, CRF2/12, IL-28R1
NCBI Gene Id163702
Protein NameInterleukin-28 receptor subunit alpha
Description of TargetIL28RA belongs to the class II cytokine receptor family. This protein forms a receptor complex with interleukine 10 receptor, beta (IL10RB). The receptor complex has been shown to interact with three closely related cytokines, including interleukin 28A (IL28A), interleukin 28B (IL28B), and interleukin 29 (IL29). The expression of all three cytokines can be induced by viral infection. The cells overexpressing this protein have been found to have enhanced responses to IL28A and IL29, but decreased response to IL28B.The protein encoded by this gene belongs to the class II cytokine receptor family. This protein forms a receptor complex with interleukine 10 receptor, beta (IL10RB). The receptor complex has been shown to interact with three closely related cytokines, including interleukin 28A (IL28A), interleukin 28B (IL28B), and interleukin 29 (IL29). The expression of all three cytokines can be induced by viral infection. The cells overexpressing this protein have been found to have enhanced responses to IL28A and IL29, but decreased response to IL28B. Three alternatively spliced transcript variants encoding distinct isoforms have been reported.
Uniprot IDQ8IU57
Protein Accession #NP_734464
Nucleotide Accession #NM_170743
Protein Size (# AA)520
Molecular Weight58kDa
Protein InteractionsIFNLR1; IFNL1; IFNL2; LSM8;
  1. What is the species homology for "IL28RA Antibody - N-terminal region (ARP48070_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Rat, Cow, Horse, Pig, Rabbit".

  2. How long will it take to receive "IL28RA Antibody - N-terminal region (ARP48070_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "IL28RA Antibody - N-terminal region (ARP48070_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "IL28RA Antibody - N-terminal region (ARP48070_P050)"?

    This target may also be called "IFNLR, LICR2, IL28RA, CRF2/12, IL-28R1" in publications.

  5. What is the shipping cost for "IL28RA Antibody - N-terminal region (ARP48070_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "IL28RA Antibody - N-terminal region (ARP48070_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "IL28RA Antibody - N-terminal region (ARP48070_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "58kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "IL28RA Antibody - N-terminal region (ARP48070_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "IFNLR1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "IFNLR1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "IFNLR1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "IFNLR1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "IFNLR1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "IFNLR1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:IL28RA Antibody - N-terminal region (ARP48070_P050)
Your Rating
We found other products you might like!