Size:100 ul
$319.00
In Stock
SKU
ARP48069_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP48069_P050-FITC Conjugated

ARP48069_P050-HRP Conjugated

ARP48069_P050-Biotin Conjugated

IL28RA Antibody - N-terminal region (ARP48069_P050)

Catalog#: ARP48069_P050
Domestic: within 1-2 days delivery | International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human IL28RA
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 92%; Dog: 100%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 77%; Rabbit: 86%; Rat: 92%
Complete computational species homology dataAnti-IL28RA (ARP48069_P050)
Peptide SequenceSynthetic peptide located within the following region: EECAGTKELLCSMMCLKKQDLYNKFKGRVRTVSPSSKSPWVESEYLDYLF
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-IFNLR1 (ARP48069_P050) antibody is Catalog # AAP48069 (Previous Catalog # AAPS21112)
Datasheets/ManualsPrintable datasheet for anti-IFNLR1 (ARP48069_P050) antibody
Subunitalpha
Target ReferenceChae,S.C., (2006) Exp. Mol. Med. 38 (3), 302-309
Publications

Mucha, J., Majchrzak, K., Taciak, B., Hellmén, E. & Król, M. MDSCs mediate angiogenesis and predispose canine mammary tumor cells for metastasis via IL-28/IL-28RA (IFN-λ) signaling. PLoS One 9, e103249 (2014). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 25075523

Gene SymbolIFNLR1
Official Gene Full NameInterleukin 28 receptor, alpha (interferon, lambda receptor)
Alias SymbolsCRF2/12, IFNLR, IFNLR1, LICR2, il-28r1, IL-28R1, IL28RA
NCBI Gene Id163702
Protein NameInterleukin-28 receptor subunit alpha
Description of TargetIL28RA belongs to the class II cytokine receptor family. This protein forms a receptor complex with interleukine 10 receptor, beta (IL10RB). The receptor complex has been shown to interact with three closely related cytokines, including interleukin 28A (IL28A), interleukin 28B (IL28B), and interleukin 29 (IL29). The expression of all three cytokines can be induced by viral infection. The cells overexpressing this protein have been found to have enhanced responses to IL28A and IL29, but decreased response to IL28B. The protein encoded by this gene belongs to the class II cytokine receptor family. This protein forms a receptor complex with interleukine 10 receptor, beta (IL10RB). The receptor complex has been shown to interact with three closely related cytokines, including interleukin 28A (IL28A), interleukin 28B (IL28B), and interleukin 29 (IL29). The expression of all three cytokines can be induced by viral infection. The cells overexpressing this protein have been found to have enhanced responses to IL28A and IL29, but decreased response to IL28B. Three alternatively spliced transcript variants encoding distinct isoforms have been reported.
Swissprot IdQ5VTX8
Protein Accession #NP_775087
Nucleotide Accession #NM_173064
Protein Size (# AA)491
Molecular Weight54kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express IL28RA.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express IL28RA.
Protein InteractionsIFNLR1; IFNL1; IFNL2; LSM8;
Write Your Own Review
You're reviewing:IL28RA Antibody - N-terminal region (ARP48069_P050)
Your Rating
Aviva Tips and Tricks
Assay Development
Aviva Travel Grant
Aviva HIS tag Deal