Size:100 ul
$319.00
In Stock
SKU
ARP48069_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP48069_P050-FITC Conjugated

ARP48069_P050-HRP Conjugated

ARP48069_P050-Biotin Conjugated

IL28RA Antibody - N-terminal region (ARP48069_P050)

Catalog#: ARP48069_P050
Domestic: within 1-2 days delivery | International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human IL28RA
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 92%; Dog: 100%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 77%; Rabbit: 86%; Rat: 92%
Complete computational species homology data Anti-IL28RA (ARP48069_P050)
Peptide Sequence Synthetic peptide located within the following region: EECAGTKELLCSMMCLKKQDLYNKFKGRVRTVSPSSKSPWVESEYLDYLF
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-IFNLR1 (ARP48069_P050) antibody is Catalog # AAP48069 (Previous Catalog # AAPS21112)
Datasheets/Manuals Printable datasheet for anti-IFNLR1 (ARP48069_P050) antibody
Subunit alpha
Target Reference Chae,S.C., (2006) Exp. Mol. Med. 38 (3), 302-309
Publications

Mucha, J., Majchrzak, K., Taciak, B., Hellmén, E. & Król, M. MDSCs mediate angiogenesis and predispose canine mammary tumor cells for metastasis via IL-28/IL-28RA (IFN-λ) signaling. PLoS One 9, e103249 (2014). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 25075523

Gene Symbol IFNLR1
Official Gene Full Name Interleukin 28 receptor, alpha (interferon, lambda receptor)
Alias Symbols CRF2/12, IFNLR, IFNLR1, LICR2, il-28r1, IL-28R1, IL28RA
NCBI Gene Id 163702
Protein Name Interleukin-28 receptor subunit alpha
Description of Target IL28RA belongs to the class II cytokine receptor family. This protein forms a receptor complex with interleukine 10 receptor, beta (IL10RB). The receptor complex has been shown to interact with three closely related cytokines, including interleukin 28A (IL28A), interleukin 28B (IL28B), and interleukin 29 (IL29). The expression of all three cytokines can be induced by viral infection. The cells overexpressing this protein have been found to have enhanced responses to IL28A and IL29, but decreased response to IL28B. The protein encoded by this gene belongs to the class II cytokine receptor family. This protein forms a receptor complex with interleukine 10 receptor, beta (IL10RB). The receptor complex has been shown to interact with three closely related cytokines, including interleukin 28A (IL28A), interleukin 28B (IL28B), and interleukin 29 (IL29). The expression of all three cytokines can be induced by viral infection. The cells overexpressing this protein have been found to have enhanced responses to IL28A and IL29, but decreased response to IL28B. Three alternatively spliced transcript variants encoding distinct isoforms have been reported.
Swissprot Id Q5VTX8
Protein Accession # NP_775087
Nucleotide Accession # NM_173064
Protein Size (# AA) 491
Molecular Weight 54kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express IL28RA.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express IL28RA.
Protein Interactions IFNLR1; IFNL1; IFNL2; LSM8;
  1. What is the species homology for "IL28RA Antibody - N-terminal region (ARP48069_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat".

  2. How long will it take to receive "IL28RA Antibody - N-terminal region (ARP48069_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "IL28RA Antibody - N-terminal region (ARP48069_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "IL28RA Antibody - N-terminal region (ARP48069_P050)"?

    This target may also be called "CRF2/12, IFNLR, IFNLR1, LICR2, il-28r1, IL-28R1, IL28RA" in publications.

  5. What is the shipping cost for "IL28RA Antibody - N-terminal region (ARP48069_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "IL28RA Antibody - N-terminal region (ARP48069_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "IL28RA Antibody - N-terminal region (ARP48069_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "54kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "IL28RA Antibody - N-terminal region (ARP48069_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "IFNLR1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "IFNLR1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "IFNLR1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "IFNLR1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "IFNLR1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "IFNLR1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:IL28RA Antibody - N-terminal region (ARP48069_P050)
Your Rating
We found other products you might like!