Search Antibody, Protein, and ELISA Kit Solutions

IL28RA Antibody - N-terminal region (ARP48069_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP48069_P050-FITC Conjugated

ARP48069_P050-HRP Conjugated

ARP48069_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human IL28RA
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 92%; Dog: 100%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 77%; Rabbit: 86%; Rat: 92%
Complete computational species homology data:
Anti-IL28RA (ARP48069_P050)
Peptide Sequence:
Synthetic peptide located within the following region: EECAGTKELLCSMMCLKKQDLYNKFKGRVRTVSPSSKSPWVESEYLDYLF
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-IFNLR1 (ARP48069_P050) antibody is Catalog # AAP48069 (Previous Catalog # AAPS21112)
Datasheets/Manuals:
Printable datasheet for anti-IFNLR1 (ARP48069_P050) antibody
Subunit:
alpha
Target Reference:
Chae,S.C., (2006) Exp. Mol. Med. 38 (3), 302-309
Publications:

Mucha, J., Majchrzak, K., Taciak, B., Hellmén, E. & Król, M. MDSCs mediate angiogenesis and predispose canine mammary tumor cells for metastasis via IL-28/IL-28RA (IFN-λ) signaling. PLoS One 9, e103249 (2014). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 25075523

Gene Symbol:
IFNLR1
Official Gene Full Name:
Interleukin 28 receptor, alpha (interferon, lambda receptor)
Alias Symbols:
CRF2/12, IFNLR, IFNLR1, LICR2, il-28r1, IL-28R1, IL28RA
NCBI Gene Id:
163702
Protein Name:
Interleukin-28 receptor subunit alpha
Description of Target:
IL28RA belongs to the class II cytokine receptor family. This protein forms a receptor complex with interleukine 10 receptor, beta (IL10RB). The receptor complex has been shown to interact with three closely related cytokines, including interleukin 28A (IL28A), interleukin 28B (IL28B), and interleukin 29 (IL29). The expression of all three cytokines can be induced by viral infection. The cells overexpressing this protein have been found to have enhanced responses to IL28A and IL29, but decreased response to IL28B. The protein encoded by this gene belongs to the class II cytokine receptor family. This protein forms a receptor complex with interleukine 10 receptor, beta (IL10RB). The receptor complex has been shown to interact with three closely related cytokines, including interleukin 28A (IL28A), interleukin 28B (IL28B), and interleukin 29 (IL29). The expression of all three cytokines can be induced by viral infection. The cells overexpressing this protein have been found to have enhanced responses to IL28A and IL29, but decreased response to IL28B. Three alternatively spliced transcript variants encoding distinct isoforms have been reported.
Swissprot Id:
Q5VTX8
Protein Accession #:
NP_775087
Nucleotide Accession #:
NM_173064
Protein Size (# AA):
491
Molecular Weight:
54kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express IL28RA.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express IL28RA.
Protein Interactions:
IFNLR1; IFNL1; IFNL2; LSM8;

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...