FGFR1OP Antibody (OAAL00564)

Catalog No: OAAL00564

Size:100UG

Western Blot analysis of FGFR1OP expression in transfected 293T cell line by FGFR1OP monoclonal antibody (M02), clone 1E8.
Lane 1: FGFR1OP transfected lysate(43.1 KDa).
Lane 2: Non-transfected lysate.

Detection limit for recombinant GST tagged FGFR1OP is 0.3 ng/ml as a capture antibody.

Product Info

• Predicted Species Reactivity: Human, Mouse
• Product Format: Liquid
• Clonality: Monoclonal
• Clone: 1E8
• Isotype: IgG1 Kappa
• Host: Mouse
• Application: Enzyme-linked immunosorbent assay|Western blot
• Reconstitution and Storage: Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
• Immunogen: FGFR1OP (AAH11902, 1 a.a. ~ 379 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Peptide Sequence: MAATAAAVVAEEDTELRDLLVQTLENSGVLNRIKAELRAAVFLALEEQEKVENKTPLVNESLRKFLNTKDGRLVASLVAEFLQFFNLDFTLAVFQPETSTLQGLEGRENLARDLGIIEAEGTVGGPLLLEVIRRCQQKEKGPTTGEGALDLSDVHSPPKSPEGKTSAQTTPSKKANDEANQSDTSVSLSEPKSKSSLHLLSHETKIGSFLSNRTLDGKDKAGLCPDEDDMEGDSFFDDPIPKPEKTYGLRNEPRKQAGSLASLSDAPPLKSGLSSLAGAPSLKDSESKRGNTVLKDLKLISDKIGSLGLGTGEDDDYVDDFNSTSHRSEKSEISIGEEIEEDLSVEIDDINTSDKLDDLTQDLTVSQLSDVADYLEDVA
• Formulation: In 1x PBS, pH 7.4

Target Info

• Gene Symbol: CEP43
• Gene Full Name: centrosomal protein 43
• Alias Symbols: centrosomal protein 43;FGFR1 oncogene partner;FGFR1OP;fibroblast growth factor receptor 1 oncogene partner;FOP.
• NCBI Gene Id: 11116
• Protein Name: FGFR1 oncogene partner [Homo sapiens]|Homo sapiens FGFR1 oncogene partner, mRNA (cDNA clone MGC:20288 IMAGE:4120239), complete cds
• Description of Target: This gene encodes a largely hydrophilic protein postulated to be a leucine-rich protein family member. A t(6;8)(q27;p11) chromosomal translocation, fusing this gene and the fibroblast growth factor receptor 1 (FGFR1) gene, has been found in cases of myeloproliferative disorder. The resulting chimeric protein contains the N-terminal leucine-rich region of this encoded protein fused to the catalytic domain of FGFR1. This gene is thought to play an important role in normal proliferation and differentiation of the erythroid lineage. Alternatively spliced transcript variants that encode different proteins have been identified. [provided by RefSeq
• Protein Accession #: https://www.ncbi.nlm.nih.gov/protein/AAH11902
• Nucleotide Accession #: https://www.ncbi.nlm.nih.gov/nuccore/BC011902