Size:100 ul
$319.00
In Stock
SKU
ARP40136_P050-FITC
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP40136_P050 Unconjugated

ARP40136_P050-HRP Conjugated

ARP40136_P050-Biotin Conjugated

Ehf Antibody - N-terminal region : FITC (ARP40136_P050-FITC)

Catalog#: ARP40136_P050-FITC
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Clonality Polyclonal
Host Rabbit
Conjugation FITC (FAM): Excitation 495 nm/ Emission 520 nm
Application IHC, WB
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Replacement Item This antibody may replace item sc-166653 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of mouse Ehf
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 93%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Sheep: 93%
Complete computational species homology data Anti-Ehf (ARP40136_P050)
Peptide Sequence Synthetic peptide located within the following region: SCIPFQEFDISGEHLCSMSLQEFTRAAGSAGQLLYSNLQHLKWNGQCSSD
Concentration 0.5 mg/ml
Blocking Peptide For anti-Ehf (ARP40136_P050-FITC) antibody is Catalog # AAP40136 (Previous Catalog # AAPP23345)
Datasheets/Manuals Printable datasheet for anti-Ehf (ARP40136_P050-FITC) antibody
Target Reference Ko,M.S., (2000) Development 127 (8), 1737-1749
Publications

He, J. et al. Profile of Ets gene expression in human breast carcinoma. Cancer Biol. Ther. 6, 76-82 (2007). WB, Mouse, Rat, Human, Pig, Horse, Rabbit, Guinea pig, Sheep, Dog, Bovine 17172821

Gene Symbol Ehf
Official Gene Full Name Ets homologous factor
Alias Symbols 9030625L19Rik, AU019492
NCBI Gene Id 13661
Protein Name ETS homologous factor
Description of Target Ehf is a transcriptional activator that may play a role in regulating epithelial cell differentiation and proliferation. It may act as a repressor for a specific subset of ETS/AP-1-responsive genes, and as a modulator of the nuclear response to mitogen-activated protein kinase signaling cascades. It binds to DNA sequences containing the consensus nucleotide core sequence GGAA and involved in regulation of TNFRSF10B/DR5 expression through Ets-binding sequences on the TNFRSF10B/DR5 promoter
Swissprot Id Q9NZC4
Protein Accession # NP_031940
Nucleotide Accession # NM_007914
Protein Size (# AA) 300
Molecular Weight 33kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express Ehf.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express Ehf.
Protein Interactions Nfkbiz;
  1. What is the species homology for "Ehf Antibody - N-terminal region : FITC (ARP40136_P050-FITC)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep".

  2. How long will it take to receive "Ehf Antibody - N-terminal region : FITC (ARP40136_P050-FITC)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "Ehf Antibody - N-terminal region : FITC (ARP40136_P050-FITC)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "Ehf Antibody - N-terminal region : FITC (ARP40136_P050-FITC)"?

    This target may also be called "9030625L19Rik, AU019492" in publications.

  5. What is the shipping cost for "Ehf Antibody - N-terminal region : FITC (ARP40136_P050-FITC)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "Ehf Antibody - N-terminal region : FITC (ARP40136_P050-FITC)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "Ehf Antibody - N-terminal region : FITC (ARP40136_P050-FITC)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "33kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "Ehf Antibody - N-terminal region : FITC (ARP40136_P050-FITC)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "EHF"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "EHF"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "EHF"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "EHF"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "EHF"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "EHF"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:Ehf Antibody - N-terminal region : FITC (ARP40136_P050-FITC)
Your Rating
We found other products you might like!