Search Antibody, Protein, and ELISA Kit Solutions

Ehf Antibody - N-terminal region : HRP (ARP40136_P050-HRP)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP40136_P050 Unconjugated

ARP40136_P050-FITC Conjugated

ARP40136_P050-Biotin Conjugated

Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Product Format:
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Gene Symbol:
Official Gene Full Name:
Ets homologous factor
NCBI Gene Id:
Protein Name:
ETS homologous factor
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
9030625L19Rik, AU019492
Replacement Item:
This antibody may replace item sc-166653 from Santa Cruz Biotechnology.
Description of Target:
Ehf is a transcriptional activator that may play a role in regulating epithelial cell differentiation and proliferation. It may act as a repressor for a specific subset of ETS/AP-1-responsive genes, and as a modulator of the nuclear response to mitogen-activated protein kinase signaling cascades. It binds to DNA sequences containing the consensus nucleotide core sequence GGAA and involved in regulation of TNFRSF10B/DR5 expression through Ets-binding sequences on the TNFRSF10B/DR5 promoter
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express Ehf.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express Ehf.
The immunogen is a synthetic peptide directed towards the N terminal region of mouse Ehf
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 93%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Sheep: 93%
Complete computational species homology data:
Anti-Ehf (ARP40136_P050)
Peptide Sequence:
Synthetic peptide located within the following region: SCIPFQEFDISGEHLCSMSLQEFTRAAGSAGQLLYSNLQHLKWNGQCSSD
0.5 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-Ehf (ARP40136_P050-HRP) antibody is Catalog # AAP40136 (Previous Catalog # AAPP23345)
Printable datasheet for anti-Ehf (ARP40136_P050-HRP) antibody
Target Reference:
Ko,M.S., (2000) Development 127 (8), 1737-1749

He, J. et al. Profile of Ets gene expression in human breast carcinoma. Cancer Biol. Ther. 6, 76-82 (2007). WB, Mouse, Rat, Human, Pig, Horse, Rabbit, Guinea pig, Sheep, Dog, Bovine 17172821

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...