Size:100 ul
$319.00
In stock
SKU
ARP40136_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP40136_P050-FITC Conjugated

ARP40136_P050-HRP Conjugated

ARP40136_P050-Biotin Conjugated

Ehf Antibody - N-terminal region (ARP40136_P050)

Catalog#: ARP40136_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human, Mouse
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-166653 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of mouse Ehf
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 93%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Sheep: 93%
Complete computational species homology data Anti-Ehf (ARP40136_P050)
Peptide Sequence Synthetic peptide located within the following region: SCIPFQEFDISGEHLCSMSLQEFTRAAGSAGQLLYSNLQHLKWNGQCSSD
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-Ehf (ARP40136_P050) antibody is Catalog # AAP40136 (Previous Catalog # AAPP23345)
Datasheets/Manuals Printable datasheet for anti-Ehf (ARP40136_P050) antibody
Target Reference Ko,M.S., (2000) Development 127 (8), 1737-1749
Publications

He, J. et al. Profile of Ets gene expression in human breast carcinoma. Cancer Biol. Ther. 6, 76-82 (2007). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep 17172821

Gene Symbol Ehf
Official Gene Full Name Ets homologous factor
Alias Symbols 9030625L19Rik, AU019492
NCBI Gene Id 13661
Protein Name ETS homologous factor
Description of Target Ehf is a transcriptional activator that may play a role in regulating epithelial cell differentiation and proliferation. It may act as a repressor for a specific subset of ETS/AP-1-responsive genes, and as a modulator of the nuclear response to mitogen-activated protein kinase signaling cascades. It binds to DNA sequences containing the consensus nucleotide core sequence GGAA and involved in regulation of TNFRSF10B/DR5 expression through Ets-binding sequences on the TNFRSF10B/DR5 promoter
Swissprot Id Q9NZC4
Protein Accession # NP_031940
Nucleotide Accession # NM_007914
Protein Size (# AA) 300
Molecular Weight 33kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express Ehf.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express Ehf.
Protein Interactions Nfkbiz;
Write Your Own Review
You're reviewing:Ehf Antibody - N-terminal region (ARP40136_P050)
Your Rating