Ehf Antibody - N-terminal region (ARP40136_P050)

Catalog No: ARP40136_P050

25 ug of the indicated Mouse whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. An isoform containing the peptide sequence is present at ~31 kDa.

WB Suggested Anti-Ehf Antibody Titration: 0.2-1 ug/ml
Positive Control: Mouse Prostate

Human kidney

Product Info

• Publications:

  He, J. et al. Profile of Ets gene expression in human breast carcinoma. Cancer Biol. Ther. 6, 76-82 (2007). 17172821

  More...

• Tested Species Reactivity: Human, Mouse
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of mouse Ehf
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 93%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Sheep: 93%
• Peptide Sequence: Synthetic peptide located within the following region: SCIPFQEFDISGEHLCSMSLQEFTRAAGSAGQLLYSNLQHLKWNGQCSSD
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-Ehf (ARP40136_P050) antibody is Catalog # AAP40136 (Previous Catalog # AAPP23345)
• Enhanced Validation:

  Relative Expression (Western Blot)

Target Info

• Reference: Ko,M.S., (2000) Development 127 (8), 1737-1749
• Gene Symbol: Ehf
• Gene Full Name: Ets homologous factor
• Alias Symbols: AU019492, 9030625L19Rik
• NCBI Gene Id: 13661
• Protein Name: ETS homologous factor
• Description of Target: Ehf is a transcriptional activator that may play a role in regulating epithelial cell differentiation and proliferation. It may act as a repressor for a specific subset of ETS/AP-1-responsive genes, and as a modulator of the nuclear response to mitogen-activated protein kinase signaling cascades. It binds to DNA sequences containing the consensus nucleotide core sequence GGAA and involved in regulation of TNFRSF10B/DR5 expression through Ets-binding sequences on the TNFRSF10B/DR5 promoter
• Uniprot ID: Q9NZC4
• Protein Accession #: NP_031940
• Nucleotide Accession #: NM_007914
• Protein Size (# AA): 300
• Molecular Weight: 35 kDa
• Protein Interactions: Nfkbiz;