Search Antibody, Protein, and ELISA Kit Solutions

Ehf antibody - N-terminal region (ARP40136_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP40136_P050-FITC Conjugated

ARP40136_P050-HRP Conjugated

ARP40136_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Ets homologous factor
Protein Name:
ETS homologous factor
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
9030625L19Rik, AU019492
Replacement Item:
This antibody may replace item sc-166653 from Santa Cruz Biotechnology.
Description of Target:
Ehf is a transcriptional activator that may play a role in regulating epithelial cell differentiation and proliferation. It may act as a repressor for a specific subset of ETS/AP-1-responsive genes, and as a modulator of the nuclear response to mitogen-activated protein kinase signaling cascades. It binds to DNA sequences containing the consensus nucleotide core sequence GGAA and involved in regulation of TNFRSF10B/DR5 expression through Ets-binding sequences on the TNFRSF10B/DR5 promoter
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express Ehf.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express Ehf.
The immunogen is a synthetic peptide directed towards the N terminal region of mouse Ehf
Tested Species Reactivity:
Human, Mouse
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 93%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Sheep: 93%
Complete computational species homology data:
Anti-Ehf (ARP40136_P050)
Peptide Sequence:
Synthetic peptide located within the following region: SCIPFQEFDISGEHLCSMSLQEFTRAAGSAGQLLYSNLQHLKWNGQCSSD
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-Ehf (ARP40136_P050) antibody is Catalog # AAP40136 (Previous Catalog # AAPP23345)
Printable datasheet for anti-Ehf (ARP40136_P050) antibody
Target Reference:
Ko,M.S., (2000) Development 127 (8), 1737-1749

He, J. et al. Profile of Ets gene expression in human breast carcinoma. Cancer Biol. Ther. 6, 76-82 (2007). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep 17172821

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...