Search Antibody, Protein, and ELISA Kit Solutions

Ehf Antibody - middle region (ARP36843_P050)

100 ul

Regular Price: $319.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP36843_P050-FITC Conjugated

ARP36843_P050-HRP Conjugated

ARP36843_P050-Biotin Conjugated

Tested Species Reactivity:
Human, Mouse
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
IHC, WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-166653 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide corresponding to a region of Mouse
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 86%; Guinea Pig: 86%; Horse: 86%; Human: 79%; Mouse: 100%; Rabbit: 86%; Rat: 100%; Sheep: 86%
Complete computational species homology data:
Anti-Ehf (ARP36843_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LFQSAHNVIVKTEQTDPSIMNTWKEENYLYDPSYGSTVDLLDSKTFCRAQ
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-Ehf (ARP36843_P050) antibody is Catalog # AAP36843 (Previous Catalog # AAPP09916)
Datasheets/Manuals:
Printable datasheet for anti-Ehf (ARP36843_P050) antibody
Gene Symbol:
Ehf
Official Gene Full Name:
Ets homologous factor
Alias Symbols:
9030625L19Rik, AU019492
NCBI Gene Id:
13661
Protein Name:
ETS homologous factor
Description of Target:
Ehf is a transcriptional activator that may play a role in regulating epithelial cell differentiation and proliferation.Ehf may act as a repressor for a specific subset of ETS/AP-1-responsive genes, and as a modulator of the nuclear response to mitogen-activated protein kinase signaling cascades.Ehf binds to DNA sequences containing the consensus nucleotide core sequence GGAA.Ehf is involved in regulation of TNFRSF10B/DR5 expression through Ets-binding sequences on the TNFRSF10B/DR5 promoter.
Swissprot Id:
O70273
Protein Accession #:
NP_031940
Nucleotide Accession #:
NM_007914
Protein Size (# AA):
300
Molecular Weight:
35kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express Ehf.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express Ehf.
Protein Interactions:
Nfkbiz;

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...