Search Antibody, Protein, and ELISA Kit Solutions

EHF Antibody - N-terminal region (ARP31861_T100)

100 ul
$229.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP31861_T100-FITC Conjugated

ARP31861_T100-HRP Conjugated

ARP31861_T100-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
IHC, WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-166653 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human EHF
Purification:
Protein A purified
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 92%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%
Complete computational species homology data:
Anti-EHF (ARP31861_T100)
Peptide Sequence:
Synthetic peptide located within the following region: RAAGTAGQLLYSNLQHLKWNGQCSSDLFQSTHNVIVKTEQTEPSIMNTWK
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-EHF (ARP31861_T100) antibody is Catalog # AAP31861 (Previous Catalog # AAPP02656)
Datasheets/Manuals:
Printable datasheet for anti-EHF (ARP31861_T100) antibody
Target Reference:
Silverman,E.S., et al., (2002) Am. J. Respir. Cell Mol. Biol. 27 (6), 697-704
Gene Symbol:
EHF
Official Gene Full Name:
Ets homologous factor
Alias Symbols:
ESE3, ESEJ, ESE3B
NCBI Gene Id:
26298
Protein Name:
ETS homologous factor
Description of Target:
EHF belongs to an ETS transcription factor subfamily characterized by epithelial-specific expression (ESEs). The encoded protein acts as a transcriptional repressor and may be associated with asthma susceptibility. This protein may be involved in epithelial differentiation and carcinogenesis.
Swissprot Id:
Q9NZC4
Protein Accession #:
NP_036285
Nucleotide Accession #:
NM_012153
Protein Size (# AA):
300
Molecular Weight:
35kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express EHF.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express EHF.
Protein Interactions:
XRCC5; XRCC6; FRZB; ELF3;

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...