Search Antibody, Protein, and ELISA Kit Solutions

EDN3 Antibody - C-terminal region : Biotin (ARP61173_P050-Biotin)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP61173_P050 Unconjugated

ARP61173_P050-FITC Conjugated

ARP61173_P050-HRP Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
Official Gene Full Name:
Endothelin 3
NCBI Gene Id:
Protein Name:
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
ET3, MGC15067, MGC61498, ET-3, WS4B, HSCR4, PPET3
Description of Target:
The protein encoded by this gene is a member of the endothelin family. Endothelins are endothelium-derived vasoactive peptides involved in a variety of biological functions. The active form of this protein is a 21 amino acid peptide processed from the precursor protein. The active peptide is a ligand for endothelin receptor type B (EDNRB). The interaction of this endothelin with EDNRB is essential for development of neural crest-derived cell lineages, such as melanocytes and enteric neurons. Mutations in this gene and EDNRB have been associated with Hirschsprung disease (HSCR) and Waardenburg syndrome (WS), which are congenital disorders involving neural crest-derived cells. Four alternatively spliced transcript variants encoding three distinct isoforms have been observed.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express EDN3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express EDN3.
Predicted Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Complete computational species homology data:
Anti-EDN3 (ARP61173_P050)
Peptide Sequence:
Synthetic peptide located within the following region: RYDKACLHFCTQTLDVSSNSRTAEKTDKEEEGKVRGANRGLCQRRLKSRT
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
0.5 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-EDN3 (ARP61173_P050-Biotin) antibody is Catalog # AAP61173
Printable datasheet for anti-EDN3 (ARP61173_P050-Biotin) antibody
Sample Type Confirmation:

EDN3 is supported by BioGPS gene expression data to be expressed in PANC1


Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...