Search Antibody, Protein, and ELISA Kit Solutions

EDN3 Antibody - C-terminal region (ARP61173_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP61173_P050-FITC Conjugated

ARP61173_P050-HRP Conjugated

ARP61173_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
EDN3
Official Gene Full Name:
Endothelin 3
NCBI Gene Id:
1908
Protein Name:
Endothelin-3
Swissprot Id:
Q7Z6D2
Protein Accession #:
NP_996915
Nucleotide Accession #:
NM_207032
Alias Symbols:
ET3, MGC15067, MGC61498, ET-3, WS4B, HSCR4, PPET3
Description of Target:
The protein encoded by this gene is a member of the endothelin family. Endothelins are endothelium-derived vasoactive peptides involved in a variety of biological functions. The active form of this protein is a 21 amino acid peptide processed from the precursor protein. The active peptide is a ligand for endothelin receptor type B (EDNRB). The interaction of this endothelin with EDNRB is essential for development of neural crest-derived cell lineages, such as melanocytes and enteric neurons. Mutations in this gene and EDNRB have been associated with Hirschsprung disease (HSCR) and Waardenburg syndrome (WS), which are congenital disorders involving neural crest-derived cells. Four alternatively spliced transcript variants encoding three distinct isoforms have been observed.
Protein Size (# AA):
219
Molecular Weight:
24kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express EDN3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express EDN3.
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Complete computational species homology data:
Anti-EDN3 (ARP61173_P050)
Peptide Sequence:
Synthetic peptide located within the following region: RYDKACLHFCTQTLDVSSNSRTAEKTDKEEEGKVRGANRGLCQRRLKSRT
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
EDNRB; EDNRA; CMA1; CTSE; KEL;
Blocking Peptide:
For anti-EDN3 (ARP61173_P050) antibody is Catalog # AAP61173
Datasheets/Manuals:
Printable datasheet for anti-EDN3 (ARP61173_P050) antibody
Sample Type Confirmation:

EDN3 is supported by BioGPS gene expression data to be expressed in PANC1

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...