Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP61173_P050-FITC Conjugated

ARP61173_P050-HRP Conjugated

ARP61173_P050-Biotin Conjugated

EDN3 Antibody - C-terminal region (ARP61173_P050)

Catalog#: ARP61173_P050
Domestic: within 1-2 days delivery | International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Human
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Human: 100%
Complete computational species homology data Anti-EDN3 (ARP61173_P050)
Peptide Sequence Synthetic peptide located within the following region: RYDKACLHFCTQTLDVSSNSRTAEKTDKEEEGKVRGANRGLCQRRLKSRT
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-EDN3 (ARP61173_P050) antibody is Catalog # AAP61173
Datasheets/Manuals Printable datasheet for anti-EDN3 (ARP61173_P050) antibody
Sample Type Confirmation

EDN3 is supported by BioGPS gene expression data to be expressed in PANC1

Gene Symbol EDN3
Official Gene Full Name Endothelin 3
Alias Symbols ET3, MGC15067, MGC61498, ET-3, WS4B, HSCR4, PPET3
NCBI Gene Id 1908
Protein Name Endothelin-3
Description of Target The protein encoded by this gene is a member of the endothelin family. Endothelins are endothelium-derived vasoactive peptides involved in a variety of biological functions. The active form of this protein is a 21 amino acid peptide processed from the precursor protein. The active peptide is a ligand for endothelin receptor type B (EDNRB). The interaction of this endothelin with EDNRB is essential for development of neural crest-derived cell lineages, such as melanocytes and enteric neurons. Mutations in this gene and EDNRB have been associated with Hirschsprung disease (HSCR) and Waardenburg syndrome (WS), which are congenital disorders involving neural crest-derived cells. Four alternatively spliced transcript variants encoding three distinct isoforms have been observed.
Swissprot Id Q7Z6D2
Protein Accession # NP_996915
Nucleotide Accession # NM_207032
Protein Size (# AA) 219
Molecular Weight 24kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express EDN3.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express EDN3.
Protein Interactions EDNRB; EDNRA; CMA1; CTSE; KEL;
  1. What is the species homology for "EDN3 Antibody - C-terminal region (ARP61173_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "EDN3 Antibody - C-terminal region (ARP61173_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "EDN3 Antibody - C-terminal region (ARP61173_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "EDN3 Antibody - C-terminal region (ARP61173_P050)"?

    This target may also be called "ET3, MGC15067, MGC61498, ET-3, WS4B, HSCR4, PPET3" in publications.

  5. What is the shipping cost for "EDN3 Antibody - C-terminal region (ARP61173_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "EDN3 Antibody - C-terminal region (ARP61173_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "EDN3 Antibody - C-terminal region (ARP61173_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "24kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "EDN3 Antibody - C-terminal region (ARP61173_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "EDN3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "EDN3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "EDN3"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "EDN3"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "EDN3"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "EDN3"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:EDN3 Antibody - C-terminal region (ARP61173_P050)
Your Rating
We found other products you might like!