EDN3 Antibody - C-terminal region : Biotin (ARP61173_P050-Biotin)

Data Sheet
 
Product Number ARP61173_P050-Biotin
Product Page www.avivasysbio.com/edn3-antibody-c-terminal-region-biotin-arp61173-p050-biotin.html
Name EDN3 Antibody - C-terminal region : Biotin (ARP61173_P050-Biotin)
Protein Size (# AA) 219 amino acids
Molecular Weight 24kDa
Conjugation Biotin
NCBI Gene Id 1908
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Endothelin 3
Alias Symbols ET3, ET-3, WS4B, HSCR4, PPET3
Peptide Sequence Synthetic peptide located within the following region: RYDKACLHFCTQTLDVSSNSRTAEKTDKEEEGKVRGANRGLCQRRLKSRT
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Description of Target The protein encoded by this gene is a member of the endothelin family. Endothelins are endothelium-derived vasoactive peptides involved in a variety of biological functions. The active form of this protein is a 21 amino acid peptide processed from the precursor protein. The active peptide is a ligand for endothelin receptor type B (EDNRB). The interaction of this endothelin with EDNRB is essential for development of neural crest-derived cell lineages, such as melanocytes and enteric neurons. Mutations in this gene and EDNRB have been associated with Hirschsprung disease (HSCR) and Waardenburg syndrome (WS), which are congenital disorders involving neural crest-derived cells. Four alternatively spliced transcript variants encoding three distinct isoforms have been observed.
Protein Interactions EDNRB; EDNRA; CMA1; CTSE; KEL;
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-EDN3 (ARP61173_P050-Biotin) antibody
Blocking Peptide For anti-EDN3 (ARP61173_P050-Biotin) antibody is Catalog # AAP61173
Uniprot ID Q7Z6D2
Protein Name Endothelin-3
Sample Type Confirmation

EDN3 is supported by BioGPS gene expression data to be expressed in PANC1

Protein Accession # NP_996915
Purification Affinity Purified
Nucleotide Accession # NM_207032
Gene Symbol EDN3
Predicted Species Reactivity Human
Application WB
Predicted Homology Based on Immunogen Sequence Human: 100%
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com