COX15 Antibody (OAAL00055)

Catalog No: OAAL00055

Size:100UG

Western Blot analysis of COX15 expression in transfected 293T cell line by COX15 monoclonal antibody (M01), clone 2D2.
Lane 1: COX15 transfected lysate (Predicted MW: 46 KDa).
Lane 2: Non-transfected lysate.

Detection limit for recombinant GST tagged COX15 is 1 ng/ml as a capture antibody.

Product Info

• Predicted Species Reactivity: Human, Mouse
• Product Format: Liquid
• Clonality: Monoclonal
• Clone: 2D2
• Isotype: IgG2a Kappa
• Host: Mouse
• Application: Enzyme-linked immunosorbent assay|Western blot
• Reconstitution and Storage: Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
• Immunogen: COX15 (NP_510870, 92 a.a. ~ 152 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Peptide Sequence: LTESGLSMVDWHLIKEMKPPTSQEEWEAEFQRYQQFPEFKILNHDMTLTEFKFIWYMEYSH
• Formulation: In 1x PBS, pH 7.4

Target Info

• Gene Symbol: COX15
• Gene Full Name: cytochrome c oxidase assembly homolog COX15
• Alias Symbols: CEMCOX2;COX15 homolog, cytochrome c oxidase assembly protein;COX15, cytochrome c oxidase assembly homolog;cytochrome c oxidase assembly homolog 15;cytochrome c oxidase assembly protein COX15 homolog;cytochrome c oxidase subunit 15;MC4DN6.
• NCBI Gene Id: 1355
• Protein Name: cytochrome c oxidase assembly protein COX15 homolog isoform 1 [Homo sapiens]|Homo sapiens cytochrome c oxidase assembly homolog COX15 (COX15), transcript variant 1, mRNA
• Description of Target: Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes a protein which is not a structural subunit, but may be essential for the biogenesis of COX formation and may function in the hydroxylation of heme O, according to the yeast mutant studies. This protein is predicted to contain 5 transmembrane domains localized in the mitochondrial inner membrane. Alternative splicing of this gene generates two transcript variants diverging in the 3' region. [provided by RefSeq
• Protein Accession #: https://www.ncbi.nlm.nih.gov/protein/NP_510870
• Nucleotide Accession #: https://www.ncbi.nlm.nih.gov/nuccore/NM_078470