Size:100 ul
$229.00
In Stock
SKU
ARP46442_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP46442_T100-FITC Conjugated

ARP46442_T100-HRP Conjugated

ARP46442_T100-Biotin Conjugated

COX15 Antibody - N-terminal region (ARP46442_T100)

Rating:
80% of 100
Catalog#: ARP46442_T100
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-104855 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human COX15
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 86%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 86%; Rat: 93%; Yeast: 82%; Zebrafish: 79%
Complete computational species homology data Anti-COX15 (ARP46442_T100)
Peptide Sequence Synthetic peptide located within the following region: DWHLIKEMKPPTSQEEWEAEFQRYQQFPEFKILNHDMTLTEFKFIWYMEY
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-COX15 (ARP46442_T100) antibody is Catalog # AAP46442 (Previous Catalog # AAPS18308)
Datasheets/Manuals Printable datasheet for anti-COX15 (ARP46442_T100) antibody
Sample Type Confirmation

COX15 is strongly supported by BioGPS gene expression data to be expressed in HepG2

Target Reference Oquendo,C.E., (2004) J. Med. Genet. 41 (7), 540-544
Publications

Swenson, S; Cannon, A; Harris, NJ; Taylor, NG; Fox, JL; Khalimonchuk, O; Analysis of Oligomerization Properties of Heme a Synthase Provides Insights into Its Function in Eukaryotes. 291, 10411-25 (2016). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish 26940873

Gene Symbol COX15
Official Gene Full Name COX15 homolog, cytochrome c oxidase assembly protein (yeast)
Alias Symbols -
NCBI Gene Id 1355
Protein Name Cytochrome c oxidase assembly protein COX15 homolog
Description of Target Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes a protein which is not a structural subunit, but may be essential for the biogenesis of COX formation and may function in the hydroxylation of heme O, according to the yeast mutant studies. This protein is predicted to contain 5 transmembrane domains localized in the mitochondrial inner membrane.Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes a protein which is not a structural subunit, but may be essential for the biogenesis of COX formation and may function in the hydroxylation of heme O, according to the yeast mutant studies. This protein is predicted to contain 5 transmembrane domains localized in the mitochondrial inner membrane. Alternative splicing of this gene generates several transcript variants diverging in the 3' region including alternate poly A sites. In total, 2 different isoforms are encoded by these variants.
Swissprot Id Q7KZN9-2
Protein Accession # NP_004367
Nucleotide Accession # NM_004376
Protein Size (# AA) 388
Molecular Weight 44kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express COX15.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express COX15.
Protein Interactions UBC; CLN3; MRPS14; NDUFA12; TOMM7; MRPL15; LAMTOR3; SURF1; NDUFS8; NDUFS6; NDUFS4; NDUFA9; CYC1;
  1. What is the species homology for "COX15 Antibody - N-terminal region (ARP46442_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish".

  2. How long will it take to receive "COX15 Antibody - N-terminal region (ARP46442_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "COX15 Antibody - N-terminal region (ARP46442_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "COX15 Antibody - N-terminal region (ARP46442_T100)"?

    This target may also be called "-" in publications.

  5. What is the shipping cost for "COX15 Antibody - N-terminal region (ARP46442_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "COX15 Antibody - N-terminal region (ARP46442_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "COX15 Antibody - N-terminal region (ARP46442_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "44kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "COX15 Antibody - N-terminal region (ARP46442_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "COX15"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "COX15"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "COX15"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "COX15"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "COX15"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "COX15"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:COX15 Antibody - N-terminal region (ARP46442_T100)
Your Rating