Search Antibody, Protein, and ELISA Kit Solutions

COX15 Antibody - N-terminal region (ARP46442_T100)

100 ul
$229.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP46442_T100-FITC Conjugated

ARP46442_T100-HRP Conjugated

ARP46442_T100-Biotin Conjugated

Gene Symbol:
COX15
Official Gene Full Name:
COX15 homolog, cytochrome c oxidase assembly protein (yeast)
NCBI Gene Id:
1355
Protein Name:
Cytochrome c oxidase assembly protein COX15 homolog
Swissprot Id:
Q7KZN9-2
Protein Accession #:
NP_004367
Nucleotide Accession #:
NM_004376
Alias Symbols:
-
Replacement Item:
This antibody may replace item sc-104855 from Santa Cruz Biotechnology.
Description of Target:
Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes a protein which is not a structural subunit, but may be essential for the biogenesis of COX formation and may function in the hydroxylation of heme O, according to the yeast mutant studies. This protein is predicted to contain 5 transmembrane domains localized in the mitochondrial inner membrane.Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes a protein which is not a structural subunit, but may be essential for the biogenesis of COX formation and may function in the hydroxylation of heme O, according to the yeast mutant studies. This protein is predicted to contain 5 transmembrane domains localized in the mitochondrial inner membrane. Alternative splicing of this gene generates several transcript variants diverging in the 3' region including alternate poly A sites. In total, 2 different isoforms are encoded by these variants.
Protein Size (# AA):
388
Molecular Weight:
44kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Protein A purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express COX15.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express COX15.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human COX15
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 86%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 86%; Rat: 93%; Yeast: 82%; Zebrafish: 79%
Complete computational species homology data:
Anti-COX15 (ARP46442_T100)
Peptide Sequence:
Synthetic peptide located within the following region: DWHLIKEMKPPTSQEEWEAEFQRYQQFPEFKILNHDMTLTEFKFIWYMEY
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; CLN3; MRPS14; NDUFA12; TOMM7; MRPL15; LAMTOR3; SURF1; NDUFS8; NDUFS6; NDUFS4; NDUFA9; CYC1;
Blocking Peptide:
For anti-COX15 (ARP46442_T100) antibody is Catalog # AAP46442 (Previous Catalog # AAPS18308)
Datasheets/Manuals:
Printable datasheet for anti-COX15 (ARP46442_T100) antibody
Sample Type Confirmation:

COX15 is strongly supported by BioGPS gene expression data to be expressed in HepG2

Target Reference:
Oquendo,C.E., (2004) J. Med. Genet. 41 (7), 540-544
Publications:

Swenson, S; Cannon, A; Harris, NJ; Taylor, NG; Fox, JL; Khalimonchuk, O; Analysis of Oligomerization Properties of Heme a Synthase Provides Insights into Its Function in Eukaryotes. 291, 10411-25 (2016). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish 26940873

Product Reviews

Average Rating:
1 review
5 star
0
4 star
1
3 star
0
2 star
0
1 star
0
  • Date - Newest First
  • Date - Newest First
  • Date - Latest First
  • Highest Rated
  • Lowest Rated
  • Most Helpful
  • Ownership

1 Item(s)

02/01/2017 16:23
  • Overall Experience:
  • Quality:
Product Review: COX15 antibody - N-terminal region (ARP46442_T100) in human fibroblast mitochondria using Western blot
Product Page for COX15 antibody - N-terminal region (ARP46442_T100)

Researcher: Oleh Khalimonchuk, University of Nebraska-Lincoln
Application: Western blot
Species + Tissue/Cell type: Lane1: 20ug human fibroblast mitochondria
Primary antibody dilution: 1:1000
Secondary antibody: Anti-rabbit HRP
Secondary antibody dilution: 1:5000


Questionnaire:
How do Aviva's reagents play a role in your experimental goals? This reagent is really important for our research
How would you rate this antibody on a scale from 1-5 (5=best) and why? 4. Very good antibody.
Would you use this antibody in future experiments? Yes
Do you believe the information about the reagent on Aviva's website is correct? Yes
How did you store the antibody after re-suspension? 4C
Sample Description (please include 1) species type, and 2) cell/tissue type, and 3) how much protein loaded for each lane of your gel): 20ug human fibroblast mitochondria
How many different experimental trials were conducted using the antibody sample? 2
How was this sample prepared? Human mitochondria - as in Humphries et al., 2005, J Biol Chem. 280:11535-11543!
Yest mitochondria - as in Diekert et al., 2001, Methods Cell Biol. 65:37-51!
Fish lysates - 70-75 embryos were selected and lyzed in a standard RIPA buffer for 30 min on ice.
Lysates were clarified at 50 000g for 20 min at 2C. Lysates were loadea "as is" or further concentrated
by TCA precipitation
Primary antibody dilution and incubation time: 1:1000 overnight (~8 hrs.) at 4C
Secondary antibody used and dilution and incubation time: 1:5000, 2 hrs. at 4C
What controls were used in your experiment (positive/negative)? mitochondria isolated from cultured primary human fibroblasts
Please include your detailed WB Procedure/Protocol here: Proteins separated by SDS-PAGE were electro-transfered to a nitrocellulose membrane in transfer buffer (192 mM Glycine, 25 mM Tris-base) by tank-blotting (3 mA/cm2 for 50 min at 4C). Transferred proteins were visualised by staining of the membrane with Ponceau S solution (0.2% (w/v) Ponceau S, 3% (w/v) TCA). Membranes were blocked in the PBS-T (1xPBS, 0.1% (v/v) Tween 20) buffer containing 5% (w/v) fat-free skimmed milk for 1 h at RT. Blocked membranes were incubated with the respective antibodies overnight at 4C. After washing with PBS-T (3x 10 min at RT) membranes were incubated for 2 hrs at 4C with horseradish peroxidase(HRP)-conjugated secondary antibodies (anti-rabbit, Jackson Labs) Membranes were washed in PBS-T (3x 10 min at RT) and detected proteins were visualized with the Immobilon Western chemiluminescent HRP substrate (Millipore) according to the manufacturer's manual.
0
0
Reply
Show more comments (-2) Hide comments

1 Item(s)

What kind of abuse are you reporting?
    Please, wait...