Now Offering Over 102,157 Antibodies & 44,722 Antigens!

BMP7 antibody - N-terminal region (ARP32329_T100)

100 ul
$249.00
In Stock

Conjugation Options

ARP32329_T100-FITC Conjugated

ARP32329_T100-HRP Conjugated

ARP32329_T100-Biotin Conjugated

Gene Symbol:
BMP7
NCBI Gene Id:
655
Official Gene Full Name:
Bone morphogenetic protein 7
Protein Name:
Bone morphogenetic protein 7
Swissprot Id:
P18075
Protein Accession #:
NP_001710
Nucleotide Accession #:
NM_001719
Alias Symbols:
OP-1
Replacement Item:
This antibody may replace item sc-34766 from Santa Cruz Biotechnology.
Description of Target:
The bone morphogenetic proteins (BMPs) are a family of secreted signaling molecules that can induce ectopic bone growth. Many BMPs are part of the transforming growth factor-beta (TGFB) superfamily. BMPs were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. Based on its expression early in embryogenesis, the BMP has a proposed role in early development. In addition, the fact that this BMP is closely related to BMP5 and BMP7 has lead to speculation of possible bone inductive activity.The bone morphogenetic proteins (BMPs) are a family of secreted signaling molecules that can induce ectopic bone growth. Many BMPs are part of the transforming growth factor-beta (TGFB) superfamily. BMPs were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. Based on its expression early in embryogenesis, the BMP encoded by this gene has a proposed role in early development. In addition, the fact that this BMP is closely related to BMP5 and BMP7 has lead to speculation of possible bone inductive activity.
Protein Size (# AA):
431
Molecular Weight:
49kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Protein A purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express BMP7.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express BMP7.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human BMP7
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 91%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 82%
Complete computational species homology data:
Anti-BMP7 (ARP32329_T100)
Peptide Sequence:
Synthetic peptide located within the following region: QGKHNSAPMFMLDLYNAMAVEEGGGPGGQGFSYPYKAVFSTQGPPLASLQ
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
NOTCH2NL; KRTAP10-3; KRTAP10-8; KRTAP10-5; KRTAP10-7; MTUS2; TRIM27; KRTAP5-9; ACTN4; BMPR2; UBC; SMAD3; SOSTDC1; CHRDL2; GDF7; BMPR1B; NOG; ACVR2B; NCOA3; BMPR1A; ENG; ACVR2A; ACVR1; SMAD1; BMP7;
Blocking Peptide:
For anti-BMP7 (ARP32329_T100) antibody is Catalog # AAP32329 (Previous Catalog # AAPP03316)
Datasheets/Manuals:
Printable datasheet for anti-BMP7 (ARP32329_T100) antibody
Target Reference:
Gregory,K.E., (2005) J. Biol. Chem. 280 (30), 27970-27980
Publications:

Morrissey, C., Brown, L. G., Pitts, T. E. M., Vessella, R. L. & Corey, E. Bone morphogenetic protein 7 is expressed in prostate cancer metastases and its effects on prostate tumor cells depend on cell phenotype and the tumor microenvironment. Neoplasia 12, 192-205 (2010). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish 20126477

Mae, S.-I. et al. Combination of small molecules enhances differentiation of mouse embryonic stem cells into intermediate mesoderm through BMP7-positive cells. Biochem. Biophys. Res. Commun. 393, 877-82 (2010). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish 20171952

Yi, T. et al. Regulation of embryonic kidney branching morphogenesis and glomerular development by KISS1 receptor (Gpr54) through NFAT2- and Sp1-mediated Bmp7 expression. J. Biol. Chem. 285, 17811-20 (2010). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish 20375015

Filion, T. M. et al. Elastomeric osteoconductive synthetic scaffolds with acquired osteoinductivity expedite the repair of critical femoral defects in rats. Tissue Eng. Part A 17, 503-11 (2011). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish 20818999

Fiaschetti, G. et al. Bone morphogenetic protein-7 is a MYC target with prosurvival functions in childhood medulloblastoma. Oncogene 30, 2823-35 (2011). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish 21317922

Rui, Y. F. et al. Expression of chondro-osteogenic BMPs in clinical samples of patellar tendinopathy. Knee Surg. Sports Traumatol. Arthrosc. 20, 1409-17 (2012). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish 21946950

Lovric, V. et al. Effects of demineralized bone matrix on tendon-bone healing in an intra-articular rodent model. Am. J. Sports Med. 40, 2365-74 (2012). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish 22984131

Whiteland, H. et al. Putative prognostic epithelial-to-mesenchymal transition biomarkers for aggressive prostate cancer. Exp. Mol. Pathol. 95, 220-6 (2013). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish 23933194

Tell us what you think about this item!

Write A Review
    Please, wait...