Catalog No: ARP32329_T100
Price: $0.00
SKU
ARP32329_T100
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-BMP7 (ARP32329_T100) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human BMP7
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 91%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 82%
Peptide SequenceSynthetic peptide located within the following region: QGKHNSAPMFMLDLYNAMAVEEGGGPGGQGFSYPYKAVFSTQGPPLASLQ
Concentration1.0 mg/ml
Blocking PeptideFor anti-BMP7 (ARP32329_T100) antibody is Catalog # AAP32329 (Previous Catalog # AAPP03316)
Enhanced Validation
WBY
SPR
YCHAROS
ReferenceGregory,K.E., (2005) J. Biol. Chem. 280 (30), 27970-27980
Publications

A self-avoidance mechanism in patterning of the urinary collecting duct tree. BMC Dev Biol. 14, 35 (2014). 25205115

Fiaschetti, G. et al. Bone morphogenetic protein-7 is a MYC target with prosurvival functions in childhood medulloblastoma. Oncogene 30, 2823-35 (2011). 21317922

Filion, T. M. et al. Elastomeric osteoconductive synthetic scaffolds with acquired osteoinductivity expedite the repair of critical femoral defects in rats. Tissue Eng. Part A 17, 503-11 (2011). 20818999

Lovric, V. et al. Effects of demineralized bone matrix on tendon-bone healing in an intra-articular rodent model. Am. J. Sports Med. 40, 2365-74 (2012). 22984131

Mae, S.-I. et al. Combination of small molecules enhances differentiation of mouse embryonic stem cells into intermediate mesoderm through BMP7-positive cells. Biochem. Biophys. Res. Commun. 393, 877-82 (2010). 20171952

Morrissey, C., Brown, L. G., Pitts, T. E. M., Vessella, R. L. & Corey, E. Bone morphogenetic protein 7 is expressed in prostate cancer metastases and its effects on prostate tumor cells depend on cell phenotype and the tumor microenvironment. Neoplasia 12, 192-205 (2010). 20126477

Rui, Y. F. et al. Expression of chondro-osteogenic BMPs in clinical samples of patellar tendinopathy. Knee Surg. Sports Traumatol. Arthrosc. 20, 1409-17 (2012). 21946950

Whiteland, H. et al. Putative prognostic epithelial-to-mesenchymal transition biomarkers for aggressive prostate cancer. Exp. Mol. Pathol. 95, 220-6 (2013). 23933194

Yi, T. et al. Regulation of embryonic kidney branching morphogenesis and glomerular development by KISS1 receptor (Gpr54) through NFAT2- and Sp1-mediated Bmp7 expression. J. Biol. Chem. 285, 17811-20 (2010). 20375015

Gene SymbolBMP7
Gene Full NameBone morphogenetic protein 7
Alias SymbolsOP-1
NCBI Gene Id655
Protein NameBone morphogenetic protein 7
Description of TargetThe bone morphogenetic proteins (BMPs) are a family of secreted signaling molecules that can induce ectopic bone growth. Many BMPs are part of the transforming growth factor-beta (TGFB) superfamily. BMPs were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. Based on its expression early in embryogenesis, the BMP has a proposed role in early development. In addition, the fact that this BMP is closely related to BMP5 and BMP7 has lead to speculation of possible bone inductive activity.The bone morphogenetic proteins (BMPs) are a family of secreted signaling molecules that can induce ectopic bone growth. Many BMPs are part of the transforming growth factor-beta (TGFB) superfamily. BMPs were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. Based on its expression early in embryogenesis, the BMP encoded by this gene has a proposed role in early development. In addition, the fact that this BMP is closely related to BMP5 and BMP7 has lead to speculation of possible bone inductive activity.
Uniprot IDP18075
Protein Accession #NP_001710
Nucleotide Accession #NM_001719
Protein Size (# AA)431
Molecular Weight49 kDa
Protein InteractionsNOTCH2NL; KRTAP10-3; KRTAP10-8; KRTAP10-5; KRTAP10-7; MTUS2; TRIM27; KRTAP5-9; ACTN4; BMPR2; UBC; SMAD3; SOSTDC1; CHRDL2; GDF7; BMPR1B; NOG; ACVR2B; NCOA3; BMPR1A; ENG; ACVR2A; ACVR1; SMAD1; BMP7;
  1. What is the species homology for "BMP7 Antibody - N-terminal region (ARP32329_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish".

  2. How long will it take to receive "BMP7 Antibody - N-terminal region (ARP32329_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "BMP7 Antibody - N-terminal region (ARP32329_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "BMP7 Antibody - N-terminal region (ARP32329_T100)"?

    This target may also be called "OP-1" in publications.

  5. What is the shipping cost for "BMP7 Antibody - N-terminal region (ARP32329_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "BMP7 Antibody - N-terminal region (ARP32329_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "BMP7 Antibody - N-terminal region (ARP32329_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "49 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "BMP7 Antibody - N-terminal region (ARP32329_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "BMP7"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "BMP7"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "BMP7"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "BMP7"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "BMP7"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "BMP7"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:BMP7 Antibody - N-terminal region (ARP32329_T100)
Your Rating
We found other products you might like!