Size:100 ul
$249.00
In stock
SKU
ARP32329_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP32329_T100-FITC Conjugated

ARP32329_T100-HRP Conjugated

ARP32329_T100-Biotin Conjugated

BMP7 Antibody - N-terminal region (ARP32329_T100)

Catalog#: ARP32329_T100
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-34766 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human BMP7
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 91%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 82%
Complete computational species homology data Anti-BMP7 (ARP32329_T100)
Peptide Sequence Synthetic peptide located within the following region: QGKHNSAPMFMLDLYNAMAVEEGGGPGGQGFSYPYKAVFSTQGPPLASLQ
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-BMP7 (ARP32329_T100) antibody is Catalog # AAP32329 (Previous Catalog # AAPP03316)
Datasheets/Manuals Printable datasheet for anti-BMP7 (ARP32329_T100) antibody
Target Reference Gregory,K.E., (2005) J. Biol. Chem. 280 (30), 27970-27980
Publications

Fiaschetti, G. et al. Bone morphogenetic protein-7 is a MYC target with prosurvival functions in childhood medulloblastoma. Oncogene 30, 2823-35 (2011). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish 21317922

Filion, T. M. et al. Elastomeric osteoconductive synthetic scaffolds with acquired osteoinductivity expedite the repair of critical femoral defects in rats. Tissue Eng. Part A 17, 503-11 (2011). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish 20818999

Lovric, V. et al. Effects of demineralized bone matrix on tendon-bone healing in an intra-articular rodent model. Am. J. Sports Med. 40, 2365-74 (2012). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish 22984131

Mae, S.-I. et al. Combination of small molecules enhances differentiation of mouse embryonic stem cells into intermediate mesoderm through BMP7-positive cells. Biochem. Biophys. Res. Commun. 393, 877-82 (2010). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish 20171952

Morrissey, C., Brown, L. G., Pitts, T. E. M., Vessella, R. L. & Corey, E. Bone morphogenetic protein 7 is expressed in prostate cancer metastases and its effects on prostate tumor cells depend on cell phenotype and the tumor microenvironment. Neoplasia 12, 192-205 (2010). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish 20126477

Rui, Y. F. et al. Expression of chondro-osteogenic BMPs in clinical samples of patellar tendinopathy. Knee Surg. Sports Traumatol. Arthrosc. 20, 1409-17 (2012). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish 21946950

Whiteland, H. et al. Putative prognostic epithelial-to-mesenchymal transition biomarkers for aggressive prostate cancer. Exp. Mol. Pathol. 95, 220-6 (2013). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish 23933194

Yi, T. et al. Regulation of embryonic kidney branching morphogenesis and glomerular development by KISS1 receptor (Gpr54) through NFAT2- and Sp1-mediated Bmp7 expression. J. Biol. Chem. 285, 17811-20 (2010). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish 20375015

Gene Symbol BMP7
Official Gene Full Name Bone morphogenetic protein 7
Alias Symbols OP-1
NCBI Gene Id 655
Protein Name Bone morphogenetic protein 7
Description of Target The bone morphogenetic proteins (BMPs) are a family of secreted signaling molecules that can induce ectopic bone growth. Many BMPs are part of the transforming growth factor-beta (TGFB) superfamily. BMPs were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. Based on its expression early in embryogenesis, the BMP has a proposed role in early development. In addition, the fact that this BMP is closely related to BMP5 and BMP7 has lead to speculation of possible bone inductive activity.The bone morphogenetic proteins (BMPs) are a family of secreted signaling molecules that can induce ectopic bone growth. Many BMPs are part of the transforming growth factor-beta (TGFB) superfamily. BMPs were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. Based on its expression early in embryogenesis, the BMP encoded by this gene has a proposed role in early development. In addition, the fact that this BMP is closely related to BMP5 and BMP7 has lead to speculation of possible bone inductive activity.
Swissprot Id P18075
Protein Accession # NP_001710
Nucleotide Accession # NM_001719
Protein Size (# AA) 431
Molecular Weight 49kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express BMP7.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express BMP7.
Protein Interactions NOTCH2NL; KRTAP10-3; KRTAP10-8; KRTAP10-5; KRTAP10-7; MTUS2; TRIM27; KRTAP5-9; ACTN4; BMPR2; UBC; SMAD3; SOSTDC1; CHRDL2; GDF7; BMPR1B; NOG; ACVR2B; NCOA3; BMPR1A; ENG; ACVR2A; ACVR1; SMAD1; BMP7;
Write Your Own Review
You're reviewing:BMP7 Antibody - N-terminal region (ARP32329_T100)
Your Rating