BMP7 Antibody - N-terminal region : FITC (ARP32329_T100-FITC)

Catalog No: ARP32329_T100-FITC

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: FITC: Fluorescein Isothiocyanate
• Application: IHC, WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human BMP7
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 91%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 82%
• Peptide Sequence: Synthetic peptide located within the following region: QGKHNSAPMFMLDLYNAMAVEEGGGPGGQGFSYPYKAVFSTQGPPLASLQ
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-BMP7 (ARP32329_T100-FITC) antibody is Catalog # AAP32329 (Previous Catalog # AAPP03316)
• Reference: Gregory,K.E., (2005) J. Biol. Chem. 280 (30), 27970-27980
• Publications:

  Morrissey, C., Brown, L. G., Pitts, T. E. M., Vessella, R. L. & Corey, E. Bone morphogenetic protein 7 is expressed in prostate cancer metastases and its effects on prostate tumor cells depend on cell phenotype and the tumor microenvironment. Neoplasia 12, 192-205 (2010). WB, IHC, ICC/IF, Pig, Human, Rabbit, Bovine, Dog, Rat, Guinea pig, Mouse, Sheep, Horse, Zebrafish 20126477

  Mae, S.-I. et al. Combination of small molecules enhances differentiation of mouse embryonic stem cells into intermediate mesoderm through BMP7-positive cells. Biochem. Biophys. Res. Commun. 393, 877-82 (2010). WB, IHC, ICC/IF, Pig, Human, Rabbit, Bovine, Dog, Rat, Guinea pig, Mouse, Sheep, Horse, Zebrafish 20171952

  Yi, T. et al. Regulation of embryonic kidney branching morphogenesis and glomerular development by KISS1 receptor (Gpr54) through NFAT2- and Sp1-mediated Bmp7 expression. J. Biol. Chem. 285, 17811-20 (2010). WB, IHC, ICC/IF, Pig, Human, Rabbit, Bovine, Dog, Rat, Guinea pig, Mouse, Sheep, Horse, Zebrafish 20375015

  Filion, T. M. et al. Elastomeric osteoconductive synthetic scaffolds with acquired osteoinductivity expedite the repair of critical femoral defects in rats. Tissue Eng. Part A 17, 503-11 (2011). WB, IHC, ICC/IF, Pig, Human, Rabbit, Bovine, Dog, Rat, Guinea pig, Mouse, Sheep, Horse, Zebrafish 20818999

  Fiaschetti, G. et al. Bone morphogenetic protein-7 is a MYC target with prosurvival functions in childhood medulloblastoma. Oncogene 30, 2823-35 (2011). WB, IHC, ICC/IF, Pig, Human, Rabbit, Bovine, Dog, Rat, Guinea pig, Mouse, Sheep, Horse, Zebrafish 21317922

  Rui, Y. F. et al. Expression of chondro-osteogenic BMPs in clinical samples of patellar tendinopathy. Knee Surg. Sports Traumatol. Arthrosc. 20, 1409-17 (2012). WB, IHC, ICC/IF, Pig, Human, Rabbit, Bovine, Dog, Rat, Guinea pig, Mouse, Sheep, Horse, Zebrafish 21946950

  Lovric, V. et al. Effects of demineralized bone matrix on tendon-bone healing in an intra-articular rodent model. Am. J. Sports Med. 40, 2365-74 (2012). WB, IHC, ICC/IF, Pig, Human, Rabbit, Bovine, Dog, Rat, Guinea pig, Mouse, Sheep, Horse, Zebrafish 22984131

  Whiteland, H. et al. Putative prognostic epithelial-to-mesenchymal transition biomarkers for aggressive prostate cancer. Exp. Mol. Pathol. 95, 220-6 (2013). WB, IHC, ICC/IF, Pig, Human, Rabbit, Bovine, Dog, Rat, Guinea pig, Mouse, Sheep, Horse, Zebrafish 23933194

Target Info

• Gene Symbol: BMP7
• Gene Full Name: Bone morphogenetic protein 7
• Alias Symbols: OP-1
• NCBI Gene Id: 655
• Protein Name: Bone morphogenetic protein 7
• Description of Target: The bone morphogenetic proteins (BMPs) are a family of secreted signaling molecules that can induce ectopic bone growth. Many BMPs are part of the transforming growth factor-beta (TGFB) superfamily. BMPs were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. Based on its expression early in embryogenesis, the BMP has a proposed role in early development. In addition, the fact that this BMP is closely related to BMP5 and BMP7 has lead to speculation of possible bone inductive activity.The bone morphogenetic proteins (BMPs) are a family of secreted signaling molecules that can induce ectopic bone growth. Many BMPs are part of the transforming growth factor-beta (TGFB) superfamily. BMPs were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. Based on its expression early in embryogenesis, the BMP encoded by this gene has a proposed role in early development. In addition, the fact that this BMP is closely related to BMP5 and BMP7 has lead to speculation of possible bone inductive activity.
• Uniprot ID: P18075
• Protein Accession #: NP_001710
• Nucleotide Accession #: NM_001719
• Protein Size (# AA): 431
• Molecular Weight: 49kDa
• Protein Interactions: NOTCH2NL; KRTAP10-3; KRTAP10-8; KRTAP10-5; KRTAP10-7; MTUS2; TRIM27; KRTAP5-9; ACTN4; BMPR2; UBC; SMAD3; SOSTDC1; CHRDL2; GDF7; BMPR1B; NOG; ACVR2B; NCOA3; BMPR1A; ENG; ACVR2A; ACVR1; SMAD1; BMP7;