SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: OOPA00051 (Formerly GWB-BSP016)
Size:2UG
Price: $75.00
SKU
OOPA00051
Availability: Domestic: within 1-2 weeks delivery | International: 1-2 weeks
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

BMP7 Antibody (OOPA00051)

Datasheets/ManualsPrintable datasheet for anti-BMP7 (OOPA00051) antibody
Product Info
Predicted Species ReactivityHuman
Product FormatSterile Filtered White lyophilized (freeze-dried) powder.
ClonalityMonoclonal
HostNicotiana benthamiana.
Additional InformationSolubility: Lyophilized BMP-7 protein should be reconstituted in distilled water to a concentration of 50 ng/ul.
::Product Introduction: The bone morphogenetic proteins (BMPs) are a family of secreted signaling molecules that can induce ectopic bone growth. Many BMPs are part of the transforming growth factor-beta (TGFB) superfamily. BMPs were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. Based on its expression early in embryogenesis, the BMP encoded by this gene has a proposed role in early development. In addition, the fact that this BMP is closely related to BMP5 and BMP7 has lead to speculation of possible bone inductive activity.
Product Description: Bone Morphogenetic Protein-7 Human Recombinant produced in Plant is a monomeric, glycosylated, polypeptide chain containing 144 amino acids and having a molecular mass of 16.5kDa, and fused to a 6xHis-tag at the N-terminus. The BMP-7 is purified by proprietary chromatographic techniques.
Reconstitution and StorageLyophilized BMP-7 although stable at room temperature for 3 weeks, should be stored desiccated below -18C. Upon reconstitution BMP 7 Human should be stored at 4C between 2-7 days and for future use below -18C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Peptide SequenceHHHHHHSTGSKQRSQNRSKTPKNQEALRMANVAEN SSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAY YCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKP CCAPTQLNAISVLYFDDSSVILKKYRNMVVRACGCH.
FormulationBMP-7 was lyophilized from a solution containing Tris-HCl 0.05M buffer at pH 7.4.
PurityGreater than 97.0% as determined by SDS-PAGE.
Biological ActivityThe biological activity of BMP-7 was measured by its ability to induce alkaline phosphatase production by ATDC5 cells, ED50 is less than 40ng/ml, corresponding to a specific activity of 25,000 units/mg.
Gene SymbolBMP7
Gene Full NameBone morphogenetic protein 7
Alias SymbolsOP-1
NCBI Gene Id655
Protein NameBone morphogenetic protein 7
Uniprot IDP18075
Protein Accession #NP_001710.1
Nucleotide Accession #NM_001719.2
Protein Size (# AA)Recombinant
  1. What is the species homology for "BMP7 Antibody (OOPA00051)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "BMP7 Antibody (OOPA00051)"?

    This item is available "Domestic: within 1-2 weeks delivery | International: 1-2 weeks".

  3. What buffer format is "BMP7 Antibody (OOPA00051)" provided in?

    This item is provided in "Sterile Filtered White lyophilized (freeze-dried) powder.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "BMP7 Antibody (OOPA00051)"?

    This target may also be called "OP-1" in publications.

  5. What is the shipping cost for "BMP7 Antibody (OOPA00051)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "BMP7 Antibody (OOPA00051)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "BMP7 Antibody (OOPA00051)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "BMP7 Antibody (OOPA00051)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "BMP7"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "BMP7"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "BMP7"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "BMP7"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "BMP7"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "BMP7"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:BMP7 Antibody (OOPA00051)
Your Rating
We found other products you might like!