SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP57862_P050-Biotin
Size:100ul
Price: $434.00
SKU
ARP57862_P050-Biotin
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

ATG4B Antibody - N-terminal region : Biotin (ARP57862_P050-Biotin)

Datasheets/ManualsPrintable datasheet for anti-ATG4B (ARP57862_P050-Biotin) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationBiotin
ApplicationWB, IHC
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human ATG4B
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 92%; Dog: 93%; Guinea Pig: 100%; Human: 100%; Mouse: 93%; Rabbit: 85%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: WGCMLRCGQMIFAQALVCRHLGRDWRWTQRKRQPDSYFSVLNAFIDRKDS
Concentration0.5 mg/ml
Blocking PeptideFor anti-ATG4B (ARP57862_P050-Biotin) antibody is Catalog # AAP57862 (Previous Catalog # AAPP32215)
ReferenceOlsen,J.V., (2006) Cell 127 (3), 635-648
Gene SymbolATG4B
Gene Full NameATG4 autophagy related 4 homolog B (S. cerevisiae)
Alias SymbolsAPG4B, AUTL1
NCBI Gene Id23192
Protein NameCysteine protease ATG4B
Description of TargetAutophagy is the process by which endogenous proteins and damaged organelles are destroyed intracellularly. Autophagy is postulated to be essential for cell homeostasis and cell remodeling during differentiation, metamorphosis, non-apoptotic cell death, and aging. Reduced levels of autophagy have been described in some malignant tumors, and a role for autophagy in controlling the unregulated cell growth linked to cancer has been proposed. ATG4B is a member of the autophagin protein family, it is also designated as a member of the C-54 family of cysteine proteases. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.Autophagy is the process by which endogenous proteins and damaged organelles are destroyed intracellularly. Autophagy is postulated to be essential for cell homeostasis and cell remodeling during differentiation, metamorphosis, non-apoptotic cell death, and aging. Reduced levels of autophagy have been described in some malignant tumors, and a role for autophagy in controlling the unregulated cell growth linked to cancer has been proposed. This gene encodes a member of the autophagin protein family. The encoded protein is also designated as a member of the C-54 family of cysteine proteases. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Uniprot IDQ9Y4P1
Protein Accession #NP_037457
Nucleotide Accession #NM_013325
Protein Size (# AA)393
Molecular Weight44kDa
Protein InteractionsSUMO2; MAP1LC3B; MAP1LC3A; BAG3; ATG8; YWHAB; GABARAPL1; SQSTM1; UBC; GABARAPL2; ATG10; ATG3; AMBRA1; GABARAP; CAMKK2; ATG12; ULK1; STK3; KRT4; ANXA1; FBXW11; LINC00341;
  1. What is the species homology for "ATG4B Antibody - N-terminal region : Biotin (ARP57862_P050-Biotin)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit".

  2. How long will it take to receive "ATG4B Antibody - N-terminal region : Biotin (ARP57862_P050-Biotin)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ATG4B Antibody - N-terminal region : Biotin (ARP57862_P050-Biotin)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ATG4B Antibody - N-terminal region : Biotin (ARP57862_P050-Biotin)"?

    This target may also be called "APG4B, AUTL1" in publications.

  5. What is the shipping cost for "ATG4B Antibody - N-terminal region : Biotin (ARP57862_P050-Biotin)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ATG4B Antibody - N-terminal region : Biotin (ARP57862_P050-Biotin)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ATG4B Antibody - N-terminal region : Biotin (ARP57862_P050-Biotin)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "44kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ATG4B Antibody - N-terminal region : Biotin (ARP57862_P050-Biotin)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ATG4B"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ATG4B"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ATG4B"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ATG4B"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ATG4B"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ATG4B"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ATG4B Antibody - N-terminal region : Biotin (ARP57862_P050-Biotin)
Your Rating
We found other products you might like!