ANXA3 Antibody - N-terminal region (ARP36578_T100)

Catalog No: ARP36578_T100

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.

Host: Rabbit
Target Name: ANXA3
Sample Tissue: Human Fetal Lung
Antibody Dilution: 1.0ug/ml

Human Spleen

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ANXA3
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Dog: 79%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 79%; Rabbit: 93%; Rat: 79%
• Peptide Sequence: Synthetic peptide located within the following region: MASIWVGHRGTVRDYPDFSPSVDAEAIQKAIRGIGTDEKMLISILTERSN
• Concentration: 1.0 mg/ml
• Blocking Peptide: For anti-ANXA3 (ARP36578_T100) antibody is Catalog # AAP36578 (Previous Catalog # AAPP07811)
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Reference: Sekar,M.C., et al., (1996) J. Biol. Chem. 271 (14), 8295-8299
• Publications:

  Bianchi, C. et al. Primary cell cultures from human renal cortex and renal-cell carcinoma evidence a differential expression of two spliced isoforms of Annexin A3. Am. J. Pathol. 176, 1660-70 (2010). 20167856

  Meyer-Schwesinger, C. et al. Nephrotic syndrome and subepithelial deposits in a mouse model of immune-mediated anti-podocyte glomerulonephritis. J. Immunol. 187, 3218-29 (2011). 21844386

  Schordan, S. et al. Alterations of the podocyte proteome in response to high glucose concentrations. Proteomics 9, 4519-28 (2009). 19688724

  Seliger, B. et al. Combined analysis of transcriptome and proteome data as a tool for the identification of candidate biomarkers in renal cell carcinoma. Proteomics 9, 1567-81 (2009). 19235166

Target Info

• Gene Symbol: ANXA3
• Gene Full Name: Annexin A3
• Alias Symbols: ANX3
• NCBI Gene Id: 306
• Protein Name: Annexin A3
• Description of Target: The ANXA3 gene encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. This protein functions in the inhibition of phopholipase A2 and cleavage of inositol 1,2-cyclic phosphate to form inositol 1-phosphate. This protein may also play a role in anti-coagulation.
• Uniprot ID: P12429
• Protein Accession #: NP_005130
• Nucleotide Accession #: NM_005139
• Protein Size (# AA): 323
• Molecular Weight: 36 kDa
• Protein Interactions: UBC; ATF2; SNAP23; STXBP2; STX4; ANXA11; ANXA4; ISG15; EMG1; IGSF21; UBR1; UNC119; TP53; REG3A;