Size:100 ul
$249.00
In Stock
SKU
ARP36578_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP36578_T100-FITC Conjugated

ARP36578_T100-HRP Conjugated

ARP36578_T100-Biotin Conjugated

ANXA3 Antibody - N-terminal region (ARP36578_T100)

Catalog#: ARP36578_T100
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Horse, Human, Rabbit
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-101511, HPA013398
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ANXA3
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Dog: 79%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 79%; Rabbit: 93%; Rat: 79%
Complete computational species homology data Anti-ANXA3 (ARP36578_T100)
Peptide Sequence Synthetic peptide located within the following region: MASIWVGHRGTVRDYPDFSPSVDAEAIQKAIRGIGTDEKMLISILTERSN
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-ANXA3 (ARP36578_T100) antibody is Catalog # AAP36578 (Previous Catalog # AAPP07811)
Datasheets/Manuals Printable datasheet for anti-ANXA3 (ARP36578_T100) antibody
Target Reference Sekar,M.C., et al., (1996) J. Biol. Chem. 271 (14), 8295-8299
Publications

Bianchi, C. et al. Primary cell cultures from human renal cortex and renal-cell carcinoma evidence a differential expression of two spliced isoforms of Annexin A3. Am. J. Pathol. 176, 1660-70 (2010). IHC, WB, Horse, Human, Rabbit 20167856

Meyer-Schwesinger, C. et al. Nephrotic syndrome and subepithelial deposits in a mouse model of immune-mediated anti-podocyte glomerulonephritis. J. Immunol. 187, 3218-29 (2011). IHC, WB, Horse, Human, Rabbit 21844386

Schordan, S. et al. Alterations of the podocyte proteome in response to high glucose concentrations. Proteomics 9, 4519-28 (2009). IHC, WB, Horse, Human, Rabbit 19688724

Seliger, B. et al. Combined analysis of transcriptome and proteome data as a tool for the identification of candidate biomarkers in renal cell carcinoma. Proteomics 9, 1567-81 (2009). IHC, WB, Horse, Human, Rabbit 19235166

Gene Symbol ANXA3
Official Gene Full Name Annexin A3
Alias Symbols ANX3
NCBI Gene Id 306
Protein Name Annexin A3
Description of Target The ANXA3 gene encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. This protein functions in the inhibition of phopholipase A2 and cleavage of inositol 1,2-cyclic phosphate to form inositol 1-phosphate. This protein may also play a role in anti-coagulation.
Swissprot Id P12429
Protein Accession # NP_005130
Nucleotide Accession # NM_005139
Protein Size (# AA) 323
Molecular Weight 36kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express ANXA3.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express ANXA3.
Protein Interactions UBC; ATF2; SNAP23; STXBP2; STX4; ANXA11; ANXA4; ISG15; EMG1; IGSF21; UBR1; UNC119; TP53; REG3A;
  1. What is the species homology for "ANXA3 Antibody - N-terminal region (ARP36578_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Horse, Human, Rabbit".

  2. How long will it take to receive "ANXA3 Antibody - N-terminal region (ARP36578_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ANXA3 Antibody - N-terminal region (ARP36578_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ANXA3 Antibody - N-terminal region (ARP36578_T100)"?

    This target may also be called "ANX3" in publications.

  5. What is the shipping cost for "ANXA3 Antibody - N-terminal region (ARP36578_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ANXA3 Antibody - N-terminal region (ARP36578_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ANXA3 Antibody - N-terminal region (ARP36578_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "36kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ANXA3 Antibody - N-terminal region (ARP36578_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "ANXA3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ANXA3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ANXA3"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ANXA3"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ANXA3"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ANXA3"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ANXA3 Antibody - N-terminal region (ARP36578_T100)
Your Rating
We found other products you might like!