Size:100 ul
$249.00
In stock
SKU
ARP36578_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP36578_T100-FITC Conjugated

ARP36578_T100-HRP Conjugated

ARP36578_T100-Biotin Conjugated

ANXA3 Antibody - N-terminal region (ARP36578_T100)

Catalog#: ARP36578_T100
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Horse, Human, Rabbit
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-101511, HPA013398
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ANXA3
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Dog: 79%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 79%; Rabbit: 93%; Rat: 79%
Complete computational species homology data Anti-ANXA3 (ARP36578_T100)
Peptide Sequence Synthetic peptide located within the following region: MASIWVGHRGTVRDYPDFSPSVDAEAIQKAIRGIGTDEKMLISILTERSN
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-ANXA3 (ARP36578_T100) antibody is Catalog # AAP36578 (Previous Catalog # AAPP07811)
Datasheets/Manuals Printable datasheet for anti-ANXA3 (ARP36578_T100) antibody
Target Reference Sekar,M.C., et al., (1996) J. Biol. Chem. 271 (14), 8295-8299
Publications

Bianchi, C. et al. Primary cell cultures from human renal cortex and renal-cell carcinoma evidence a differential expression of two spliced isoforms of Annexin A3. Am. J. Pathol. 176, 1660-70 (2010). IHC, WB, Horse, Human, Rabbit 20167856

Meyer-Schwesinger, C. et al. Nephrotic syndrome and subepithelial deposits in a mouse model of immune-mediated anti-podocyte glomerulonephritis. J. Immunol. 187, 3218-29 (2011). IHC, WB, Horse, Human, Rabbit 21844386

Schordan, S. et al. Alterations of the podocyte proteome in response to high glucose concentrations. Proteomics 9, 4519-28 (2009). IHC, WB, Horse, Human, Rabbit 19688724

Seliger, B. et al. Combined analysis of transcriptome and proteome data as a tool for the identification of candidate biomarkers in renal cell carcinoma. Proteomics 9, 1567-81 (2009). IHC, WB, Horse, Human, Rabbit 19235166

Gene Symbol ANXA3
Official Gene Full Name Annexin A3
Alias Symbols ANX3
NCBI Gene Id 306
Protein Name Annexin A3
Description of Target The ANXA3 gene encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. This protein functions in the inhibition of phopholipase A2 and cleavage of inositol 1,2-cyclic phosphate to form inositol 1-phosphate. This protein may also play a role in anti-coagulation.
Swissprot Id P12429
Protein Accession # NP_005130
Nucleotide Accession # NM_005139
Protein Size (# AA) 323
Molecular Weight 36kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express ANXA3.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express ANXA3.
Protein Interactions UBC; ATF2; SNAP23; STXBP2; STX4; ANXA11; ANXA4; ISG15; EMG1; IGSF21; UBR1; UNC119; TP53; REG3A;
Write Your Own Review
You're reviewing:ANXA3 Antibody - N-terminal region (ARP36578_T100)
Your Rating