Catalog No: ARP36578_T100
Price: $0.00
SKU
ARP36578_T100
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-ANXA3 (ARP36578_T100) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human ANXA3
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceDog: 79%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 79%; Rabbit: 93%; Rat: 79%
Peptide SequenceSynthetic peptide located within the following region: MASIWVGHRGTVRDYPDFSPSVDAEAIQKAIRGIGTDEKMLISILTERSN
Concentration1.0 mg/ml
Blocking PeptideFor anti-ANXA3 (ARP36578_T100) antibody is Catalog # AAP36578 (Previous Catalog # AAPP07811)
Enhanced Validation
WBY
SPR
YCHAROS
ReferenceSekar,M.C., et al., (1996) J. Biol. Chem. 271 (14), 8295-8299
Publications

Bianchi, C. et al. Primary cell cultures from human renal cortex and renal-cell carcinoma evidence a differential expression of two spliced isoforms of Annexin A3. Am. J. Pathol. 176, 1660-70 (2010). 20167856

Meyer-Schwesinger, C. et al. Nephrotic syndrome and subepithelial deposits in a mouse model of immune-mediated anti-podocyte glomerulonephritis. J. Immunol. 187, 3218-29 (2011). 21844386

Schordan, S. et al. Alterations of the podocyte proteome in response to high glucose concentrations. Proteomics 9, 4519-28 (2009). 19688724

Seliger, B. et al. Combined analysis of transcriptome and proteome data as a tool for the identification of candidate biomarkers in renal cell carcinoma. Proteomics 9, 1567-81 (2009). 19235166

Gene SymbolANXA3
Gene Full NameAnnexin A3
Alias SymbolsANX3
NCBI Gene Id306
Protein NameAnnexin A3
Description of TargetThe ANXA3 gene encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. This protein functions in the inhibition of phopholipase A2 and cleavage of inositol 1,2-cyclic phosphate to form inositol 1-phosphate. This protein may also play a role in anti-coagulation.
Uniprot IDP12429
Protein Accession #NP_005130
Nucleotide Accession #NM_005139
Protein Size (# AA)323
Molecular Weight36 kDa
Protein InteractionsUBC; ATF2; SNAP23; STXBP2; STX4; ANXA11; ANXA4; ISG15; EMG1; IGSF21; UBR1; UNC119; TP53; REG3A;
  1. What is the species homology for "ANXA3 Antibody - N-terminal region (ARP36578_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Horse, Rabbit".

  2. How long will it take to receive "ANXA3 Antibody - N-terminal region (ARP36578_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ANXA3 Antibody - N-terminal region (ARP36578_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ANXA3 Antibody - N-terminal region (ARP36578_T100)"?

    This target may also be called "ANX3" in publications.

  5. What is the shipping cost for "ANXA3 Antibody - N-terminal region (ARP36578_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ANXA3 Antibody - N-terminal region (ARP36578_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ANXA3 Antibody - N-terminal region (ARP36578_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "36 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ANXA3 Antibody - N-terminal region (ARP36578_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ANXA3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ANXA3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ANXA3"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ANXA3"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ANXA3"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ANXA3"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ANXA3 Antibody - N-terminal region (ARP36578_T100)
Your Rating
We found other products you might like!