Aviva Systems Biology office will be closed for Memorial Day - May 27, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

ANXA3 Antibody - N-terminal region (ARP36578_T100)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP36578_T100-FITC Conjugated

ARP36578_T100-HRP Conjugated

ARP36578_T100-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Annexin A3
NCBI Gene Id:
Protein Name:
Annexin A3
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-101511, HPA013398
Description of Target:
The ANXA3 gene encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. This protein functions in the inhibition of phopholipase A2 and cleavage of inositol 1,2-cyclic phosphate to form inositol 1-phosphate. This protein may also play a role in anti-coagulation.
Protein Size (# AA):
Molecular Weight:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ANXA3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ANXA3.
The immunogen is a synthetic peptide directed towards the N terminal region of human ANXA3
Predicted Species Reactivity:
Horse, Human, Rabbit
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Dog: 79%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 79%; Rabbit: 93%; Rat: 79%
Complete computational species homology data:
Anti-ANXA3 (ARP36578_T100)
Peptide Sequence:
Synthetic peptide located within the following region: MASIWVGHRGTVRDYPDFSPSVDAEAIQKAIRGIGTDEKMLISILTERSN
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-ANXA3 (ARP36578_T100) antibody is Catalog # AAP36578 (Previous Catalog # AAPP07811)
Printable datasheet for anti-ANXA3 (ARP36578_T100) antibody
Target Reference:
Sekar,M.C., et al., (1996) J. Biol. Chem. 271 (14), 8295-8299

Bianchi, C. et al. Primary cell cultures from human renal cortex and renal-cell carcinoma evidence a differential expression of two spliced isoforms of Annexin A3. Am. J. Pathol. 176, 1660-70 (2010). IHC, WB, Horse, Human, Rabbit 20167856

Meyer-Schwesinger, C. et al. Nephrotic syndrome and subepithelial deposits in a mouse model of immune-mediated anti-podocyte glomerulonephritis. J. Immunol. 187, 3218-29 (2011). IHC, WB, Horse, Human, Rabbit 21844386

Schordan, S. et al. Alterations of the podocyte proteome in response to high glucose concentrations. Proteomics 9, 4519-28 (2009). IHC, WB, Horse, Human, Rabbit 19688724

Seliger, B. et al. Combined analysis of transcriptome and proteome data as a tool for the identification of candidate biomarkers in renal cell carcinoma. Proteomics 9, 1567-81 (2009). IHC, WB, Horse, Human, Rabbit 19235166

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...