ANXA3 Antibody - N-terminal region (ARP36578_T100)

Data Sheet
 
Product Number ARP36578_T100
Product Page www.avivasysbio.com/anxa3-antibody-n-terminal-region-arp36578-t100.html
Product Name ANXA3 Antibody - N-terminal region (ARP36578_T100)
Size 100 ul
Gene Symbol ANXA3
Alias Symbols ANX3
Protein Size (# AA) 323 amino acids
Molecular Weight 36kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 306
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name Annexin A3
Peptide Sequence Synthetic peptide located within the following region: MASIWVGHRGTVRDYPDFSPSVDAEAIQKAIRGIGTDEKMLISILTERSN
Target Reference Sekar,M.C., et al., (1996) J. Biol. Chem. 271 (14), 8295-8299
Description of Target The ANXA3 gene encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. This protein functions in the inhibition of phopholipase A2 and cleavage of inositol 1,2-cyclic phosphate to form inositol 1-phosphate. This protein may also play a role in anti-coagulation.
Protein Interactions UBC; ATF2; SNAP23; STXBP2; STX4; ANXA11; ANXA4; ISG15; EMG1; IGSF21; UBR1; UNC119; TP53; REG3A;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Tips Information

See our General FAQ page.

Datasheets/Manuals Printable datasheet for anti-ANXA3 (ARP36578_T100) antibody
Protocol
The following related protocols are available on www.avivasysbio.com
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-ANXA3 (ARP36578_T100) antibody is Catalog # AAP36578 (Previous Catalog # AAPP07811)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ANXA3
Complete computational species homology data Anti-ANXA3 (ARP36578_T100)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express ANXA3.
Swissprot Id P12429
Protein Name Annexin A3
Publications

Bianchi, C. et al. Primary cell cultures from human renal cortex and renal-cell carcinoma evidence a differential expression of two spliced isoforms of Annexin A3. Am. J. Pathol. 176, 1660-70 (2010). IHC, WB, Horse, Human, Rabbit 20167856

Meyer-Schwesinger, C. et al. Nephrotic syndrome and subepithelial deposits in a mouse model of immune-mediated anti-podocyte glomerulonephritis. J. Immunol. 187, 3218-29 (2011). IHC, WB, Horse, Human, Rabbit 21844386

Schordan, S. et al. Alterations of the podocyte proteome in response to high glucose concentrations. Proteomics 9, 4519-28 (2009). IHC, WB, Horse, Human, Rabbit 19688724

Seliger, B. et al. Combined analysis of transcriptome and proteome data as a tool for the identification of candidate biomarkers in renal cell carcinoma. Proteomics 9, 1567-81 (2009). IHC, WB, Horse, Human, Rabbit 19235166

Protein Accession # NP_005130
Purification Protein A purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express ANXA3.
Nucleotide Accession # NM_005139
Replacement Item This antibody may replace item sc-101511, HPA013398
Tested Species Reactivity Human
Predicted Species Reactivity Horse, Human, Rabbit
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Dog: 79%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 79%; Rabbit: 93%; Rat: 79%
Image 1
Human Spleen
Human Spleen
Image 2
Human Fetal Lung
Host: Rabbit
Target Name: ANXA3
Sample Tissue: Human Fetal Lung
Antibody Dilution: 1.0ug/ml
Image 3
A549, MCF7
Host: Rabbit
Target: ANXA3
Positive control (+): A549 (N03)
Negative control (-): MCF7 (N10)
Antibody concentration: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
7700 Ronson Road, Ste 100, San Diego, CA 92111 USA | Tel: (858)552-6979 | info@avivasysbio.com