ANXA3 Antibody - N-terminal region (ARP36578_T100)

Data Sheet
 
Product Number ARP36578_T100
Product Page www.avivasysbio.com/anxa3-antibody-n-terminal-region-arp36578-t100.html
Name ANXA3 Antibody - N-terminal region (ARP36578_T100)
Protein Size (# AA) 323 amino acids
Molecular Weight 36 kDa
NCBI Gene Id 306
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Annexin A3
Alias Symbols ANX3
Peptide Sequence Synthetic peptide located within the following region: MASIWVGHRGTVRDYPDFSPSVDAEAIQKAIRGIGTDEKMLISILTERSN
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Sekar,M.C., et al., (1996) J. Biol. Chem. 271 (14), 8295-8299
Description of Target The ANXA3 gene encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. This protein functions in the inhibition of phopholipase A2 and cleavage of inositol 1,2-cyclic phosphate to form inositol 1-phosphate. This protein may also play a role in anti-coagulation.
Protein Interactions UBC; ATF2; SNAP23; STXBP2; STX4; ANXA11; ANXA4; ISG15; EMG1; IGSF21; UBR1; UNC119; TP53; REG3A;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Enhanced Validation
Relative Expression (Western Blot) Avivasheild
Datasheets/Manuals Printable datasheet for anti-ANXA3 (ARP36578_T100) antibody
Blocking Peptide For anti-ANXA3 (ARP36578_T100) antibody is Catalog # AAP36578 (Previous Catalog # AAPP07811)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ANXA3
Uniprot ID P12429
Protein Name Annexin A3
Publications

Bianchi, C. et al. Primary cell cultures from human renal cortex and renal-cell carcinoma evidence a differential expression of two spliced isoforms of Annexin A3. Am. J. Pathol. 176, 1660-70 (2010). 20167856

Meyer-Schwesinger, C. et al. Nephrotic syndrome and subepithelial deposits in a mouse model of immune-mediated anti-podocyte glomerulonephritis. J. Immunol. 187, 3218-29 (2011). 21844386

Schordan, S. et al. Alterations of the podocyte proteome in response to high glucose concentrations. Proteomics 9, 4519-28 (2009). 19688724

Seliger, B. et al. Combined analysis of transcriptome and proteome data as a tool for the identification of candidate biomarkers in renal cell carcinoma. Proteomics 9, 1567-81 (2009). 19235166

Protein Accession # NP_005130
Purification Protein A purified
Nucleotide Accession # NM_005139
Tested Species Reactivity Human
Gene Symbol ANXA3
Predicted Species Reactivity Human, Horse, Rabbit
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Dog: 79%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 79%; Rabbit: 93%; Rat: 79%
Image 1
Human Fetal Lung
Host: Rabbit
Target Name: ANXA3
Sample Tissue: Human Fetal Lung
Antibody Dilution: 1.0ug/ml
Image 2
Human Spleen
Human Spleen
Image 3
Western Blot
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com