Product Number |
ARP36578_T100 |
Product Page |
www.avivasysbio.com/anxa3-antibody-n-terminal-region-arp36578-t100.html |
Name |
ANXA3 Antibody - N-terminal region (ARP36578_T100) |
Protein Size (# AA) |
323 amino acids |
Molecular Weight |
36 kDa |
NCBI Gene Id |
306 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Annexin A3 |
Alias Symbols |
ANX3 |
Peptide Sequence |
Synthetic peptide located within the following region: MASIWVGHRGTVRDYPDFSPSVDAEAIQKAIRGIGTDEKMLISILTERSN |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Sekar,M.C., et al., (1996) J. Biol. Chem. 271 (14), 8295-8299 |
Description of Target |
The ANXA3 gene encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. This protein functions in the inhibition of phopholipase A2 and cleavage of inositol 1,2-cyclic phosphate to form inositol 1-phosphate. This protein may also play a role in anti-coagulation. |
Protein Interactions |
UBC; ATF2; SNAP23; STXBP2; STX4; ANXA11; ANXA4; ISG15; EMG1; IGSF21; UBR1; UNC119; TP53; REG3A; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Enhanced Validation |
Relative Expression (Western Blot) |
|
|
Datasheets/Manuals |
Printable datasheet for anti-ANXA3 (ARP36578_T100) antibody |
Blocking Peptide |
For anti-ANXA3 (ARP36578_T100) antibody is Catalog # AAP36578 (Previous Catalog # AAPP07811) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ANXA3 |
Uniprot ID |
P12429 |
Protein Name |
Annexin A3 |
Publications |
Bianchi, C. et al. Primary cell cultures from human renal cortex and renal-cell carcinoma evidence a differential expression of two spliced isoforms of Annexin A3. Am. J. Pathol. 176, 1660-70 (2010). 20167856
Meyer-Schwesinger, C. et al. Nephrotic syndrome and subepithelial deposits in a mouse model of immune-mediated anti-podocyte glomerulonephritis. J. Immunol. 187, 3218-29 (2011). 21844386
Schordan, S. et al. Alterations of the podocyte proteome in response to high glucose concentrations. Proteomics 9, 4519-28 (2009). 19688724
Seliger, B. et al. Combined analysis of transcriptome and proteome data as a tool for the identification of candidate biomarkers in renal cell carcinoma. Proteomics 9, 1567-81 (2009). 19235166 |
Protein Accession # |
NP_005130 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_005139 |
Tested Species Reactivity |
Human |
Gene Symbol |
ANXA3 |
Predicted Species Reactivity |
Human, Horse, Rabbit |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Dog: 79%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 79%; Rabbit: 93%; Rat: 79% |
Image 1 | Human Fetal Lung
| Host: Rabbit Target Name: ANXA3 Sample Tissue: Human Fetal Lung Antibody Dilution: 1.0ug/ml |
|
Image 2 | Human Spleen
| Human Spleen |
|
Image 3 | Western Blot
| 25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. |
|