WNK2 Antibody (OAAL00800)

Catalog No: OAAL00800

Size:100UG

Product Info

• Predicted Species Reactivity: Human, Mouse
• Product Format: Liquid
• Clonality: Monoclonal
• Clone: 2A2
• Isotype: IgG1 Kappa
• Host: Mouse
• Application: Enzyme-linked immunosorbent assay|Western blot
• Reconstitution and Storage: Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
• Immunogen: WNK2 (NP_006639, 2118 a.a. ~ 2217 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Peptide Sequence: KGTFTDDLHKLVDEWTSKTVGAAQLKPTLNQLKQTQKLQDMEAQAGWAAPGEARAMTAPRAGVGMPRLPPAPGPLSTTVIPGAAPTLSVPTPDPESEKPD
• Formulation: In 1x PBS, pH 7.4

Target Info

• Gene Symbol: WNK2
• Gene Full Name: WNK lysine deficient protein kinase 2
• Alias Symbols: antigen NY-CO-43;mitogen-activated protein kinase kinase kinase;NY-CO-43;P/OKcl.13;PRKWNK2;protein kinase lysine-deficient 2;protein kinase with no lysine 2;SDCCAG43;serine/threonine-protein kinase WNK2;serologically defined colon cancer antigen 43.
• NCBI Gene Id: 65268
• Protein Name: Homo sapiens WNK lysine deficient protein kinase 2 (WNK2), transcript variant 2, mRNA|serine/threonine-protein kinase WNK2 isoform 2 [Homo sapiens]
• Description of Target: The protein encoded by this gene is a cytoplasmic serine-threonine kinase that contains cysteine in place of the lysine found at the conserved ATP-binding location in subdomain II of protein kinases. Since this protein does have kinase activity, it is possible that another lysine in the kinase subdomain I can substitute for the missing conserved lysine. [provided by RefSeq
• Protein Accession #: https://www.ncbi.nlm.nih.gov/protein/NP_006639
• Nucleotide Accession #: https://www.ncbi.nlm.nih.gov/nuccore/NM_006648