Search Antibody, Protein, and ELISA Kit Solutions

TAP1 antibody - middle region (ARP43628_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP43628_P050-FITC Conjugated

ARP43628_P050-HRP Conjugated

ARP43628_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Transporter 1, ATP-binding cassette, sub-family B (MDR/TAP)
Protein Name:
Antigen peptide transporter 1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
ABC17, ABCB2, APT1, D6S114E, FLJ26666, FLJ41500, PSF1, RING4, TAP1*0102N, TAP1N, PSF-1
Replacement Item:
This antibody may replace item sc-11464 from Santa Cruz Biotechnology.
Description of Target:
The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). TAP1 is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. TAP1 is involved in the pumping of degraded cytosolic peptides across the endoplasmic reticulum into the membrane-bound compartment where class I molecules assemble.The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. The protein encoded by this gene is involved in the pumping of degraded cytosolic peptides across the endoplasmic reticulum into the membrane-bound compartment where class I molecules assemble. Mutations in this gene may be associated with ankylosing spondylitis, insulin-dependent diabetes mellitus, and celiac disease. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TAP1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TAP1.
The immunogen is a synthetic peptide directed towards the middle region of human TAP1
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 92%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 92%; Rat: 100%; Zebrafish: 83%
Complete computational species homology data:
Anti-TAP1 (ARP43628_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LVTFVLYQMQFTQAVEVLLSIYPRVQKAVGSSEKIFEYLDRTPRCPPSGL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-TAP1 (ARP43628_P050) antibody is Catalog # AAP43628 (Previous Catalog # AAPP11617)
Printable datasheet for anti-TAP1 (ARP43628_P050) antibody
Sample Type Confirmation:

TAP1 is supported by BioGPS gene expression data to be expressed in HeLa

Target Reference:
Soundravally,R. (2008) Scand. J. Immunol. 67 (6), 618-625

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...