TAP1 Antibody (OAAL00325)

Catalog No: OAAL00325

Size:100UG

Detection limit for recombinant GST tagged TAP1 is approximately 1ng/ml as a capture antibody.

Product Info

• Predicted Species Reactivity: Human, Mouse
• Product Format: Liquid
• Clonality: Monoclonal
• Clone: 1B11
• Isotype: IgG3 Kappa
• Host: Mouse
• Application: Enzyme-linked immunosorbent assay|Western blot
• Reconstitution and Storage: Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
• Immunogen: TAP1 (AAH14081, 241 a.a. ~ 350 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Peptide Sequence: GSETRRLSLFLVLVVLSSLGEMAIPFFTGRLTDWILQDGSADTFTRNLTLMSILTIASAVLEFVGDGIYNNTMGHVHSHLQGEVFGAVLRQETEFFQQNQTGNIMSRVTE
• Formulation: In 1x PBS, pH 7.4

Target Info

• Gene Symbol: TAP1
• Gene Full Name: transporter 1, ATP binding cassette subfamily B member
• Alias Symbols: ABC transporter, MHC 1;ABC17;ABCB2;antigen peptide transporter 1;APT1;ATP-binding cassette sub-family B member 2;ATP-binding cassette, sub-family B (MDR/TAP), member 2;D6S114E;peptide supply factor 1;peptide transporter involved in antigen processing 1;peptide transporter PSF1;peptide transporter TAP1;PSF1;PSF-1;really interesting new gene 4 protein;RING4;TAP1*0102N;TAP1N;transporter 1 ATP-binding cassette sub-family B;transporter 1, ATP-binding cassette, sub-family B (MDR/TAP);transporter associated with antigen processing;transporter, ATP-binding cassette, major histocompatibility complex, 1.
• NCBI Gene Id: 6890
• Protein Name: Homo sapiens transporter 1, ATP-binding cassette, sub-family B (MDR/TAP), mRNA (cDNA clone MGC:20334 IMAGE:4304716), complete cds|Transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) [Homo sapiens]
• Description of Target: The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. The protein encoded by this gene is involved in the pumping of degraded cytosolic peptides across the endoplasmic reticulum into the membrane-bound compartment where class I molecules assemble. Mutations in this gene may be associated with ankylosing spondylitis, insulin-dependent diabetes mellitus, and celiac disease. [provided by RefSeq
• Protein Accession #: https://www.ncbi.nlm.nih.gov/protein/AAH14081
• Nucleotide Accession #: https://www.ncbi.nlm.nih.gov/nuccore/BC014081