- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for TAF11 Antibody (OAAL00323) |
---|
Predicted Species Reactivity | Human, Mouse |
---|---|
Product Format | Liquid |
Clonality | Monoclonal |
Clone | 3H5 |
Isotype | IgG1 Kappa |
Host | Mouse |
Application | Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry-Paraffin|Western blot |
Reconstitution and Storage | Store at -20C or lower. Aliquot to avoid repeated freezing and thawing. |
Immunogen | TAF11 (NP_005634, 158 a.a. ~ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Peptide Sequence | SKVFVGEVVEEALDVCEKWGEMPPLQPKHMREAVRRLKSKGQIPNSKHKKIIF |
Formulation | In 1x PBS, pH 7.4 |
Gene Symbol | TAF11 |
---|---|
Gene Full Name | TATA-box binding protein associated factor 11 |
Alias Symbols | MGC:15243;PRO2134;TAF(II)28;TAF11 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 28kDa;TAF2I;TAFII28;TAFII-28;TATA box binding protein (TBP)-associated factor, RNA polymerase II, I, 28kD;TFIID subunit p30-beta;transcription initiation factor TFIID 28 kD subunit;transcription initiation factor TFIID 28 kDa subunit;transcription initiation factor TFIID subunit 11. |
NCBI Gene Id | 6882 |
Protein Name | Homo sapiens TATA-box binding protein associated factor 11 (TAF11), transcript variant 1, mRNA|transcription initiation factor TFIID subunit 11 isoform 1 [Homo sapiens] |
Description of Target | Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes a small subunit of TFIID that is present in all TFIID complexes and interacts with TBP. This subunit also interacts with another small subunit, TAF13, to form a heterodimer with a structure similar to the histone core structure. [provided by RefSeq |
Protein Accession # | https://www.ncbi.nlm.nih.gov/protein/NP_005634 |
Nucleotide Accession # | https://www.ncbi.nlm.nih.gov/nuccore/NM_005643 |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "TAF11 Antibody (OAAL00323)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse".
-
How long will it take to receive "TAF11 Antibody (OAAL00323)"?
This item is available "Domestic: within 2-3 week delivery | International: 2-3 weeks".
-
What buffer format is "TAF11 Antibody (OAAL00323)" provided in?
This item is provided in "Liquid".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "TAF11 Antibody (OAAL00323)"?
This target may also be called "MGC:15243;PRO2134;TAF(II)28;TAF11 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 28kDa;TAF2I;TAFII28;TAFII-28;TATA box binding protein (TBP)-associated factor, RNA polymerase II, I, 28kD;TFIID subunit p30-beta;transcription initiation factor TFIID 28 kD subunit;transcription initiation factor TFIID 28 kDa subunit;transcription initiation factor TFIID subunit 11." in publications.
-
What is the shipping cost for "TAF11 Antibody (OAAL00323)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "TAF11 Antibody (OAAL00323)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "TAF11 Antibody (OAAL00323)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "TAF11 Antibody (OAAL00323)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "TAF11"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "TAF11"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "TAF11"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "TAF11"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "TAF11"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "TAF11"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.