SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP32472_P050-Biotin
Size:100ul
Price: $434.00
SKU
ARP32472_P050-Biotin
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

TAF1 Antibody - middle region : Biotin (ARP32472_P050-Biotin)

Datasheets/ManualsPrintable datasheet for anti-TAF1 (ARP32472_P050-Biotin) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationBiotin
ApplicationWB, CHIP
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human TAF1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: MMSYEGDGGEASHGLEDSNISYGSYEEPDPKSNTQDTSFSSIGGYEVSEE
Concentration0.5 mg/ml
Blocking PeptideFor anti-TAF1 (ARP32472_P050-Biotin) antibody is Catalog # AAP32472 (Previous Catalog # AAPP03470)
Subunit1
ReferenceHerzfeld,T., (2007) Mamm. Genome 18 (11), 787-795
Gene SymbolTAF1
Gene Full NameTAF1 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 250kDa
Alias SymbolsOF, XDP, BA2R, CCG1, CCGS, DYT3, KAT4, P250, NSCL2, TAF2A, MRXS33, N-TAF1, TAFII250, DYT3/TAF1, TAFII-250, TAF(II)250
NCBI Gene Id6872
Protein NameTranscription initiation factor TFIID subunit 1
Description of TargetInitiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is the basal transcription factor TFIID, which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. TAF1 encodes the largest subunit of TFIID. This subunit binds to core promoter sequences encompassing the transcription start site. It also binds to activators and other transcriptional regulators, and these interactions affect the rate of transcription initiation. This subunit contains two independent protein kinase domains at the N and C-terminals, but also possesses acetyltransferase activity and can act as a ubiquitin-activating/conjugating enzyme. Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is the basal transcription factor TFIID, which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes the largest subunit of TFIID. This subunit binds to core promoter sequences encompassing the transcription start site. It also binds to activators and other transcriptional regulators, and these interactions affect the rate of transcription initiation. This subunit contains two independent protein kinase domains at the N and C-terminals, but also possesses acetyltransferase activity and can act as a ubiquitin-activating/conjugating enzyme. Two transcripts encoding different isoforms have been identified for this gene.
Uniprot IDP21675-2
Protein Accession #NP_004597
Nucleotide Accession #NM_004606
Protein Size (# AA)1893
Molecular Weight215kDa
Protein InteractionsAR; UBE2I; TAF4B; HIST3H3; UBC; TBP; MED26; TAF3; TAF9B; TAF7; TAF6; TAF5; TAF4; TAF2; CCNT1; GFI1B; TP53; MEN1; GTF2F1; BRMS1; PHF8; PAX3; CTCF; HIST1H4A; HIST1H3A; TAF8; MDM2; ASF1A; SIN3A; ALL1; SMARCA2; APC; RANBP2; MAX; TBPL1; TAF13; TAF10; ASF1B; TA
  1. What is the species homology for "TAF1 Antibody - middle region : Biotin (ARP32472_P050-Biotin)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit".

  2. How long will it take to receive "TAF1 Antibody - middle region : Biotin (ARP32472_P050-Biotin)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "TAF1 Antibody - middle region : Biotin (ARP32472_P050-Biotin)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "TAF1 Antibody - middle region : Biotin (ARP32472_P050-Biotin)"?

    This target may also be called "OF, XDP, BA2R, CCG1, CCGS, DYT3, KAT4, P250, NSCL2, TAF2A, MRXS33, N-TAF1, TAFII250, DYT3/TAF1, TAFII-250, TAF(II)250" in publications.

  5. What is the shipping cost for "TAF1 Antibody - middle region : Biotin (ARP32472_P050-Biotin)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "TAF1 Antibody - middle region : Biotin (ARP32472_P050-Biotin)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "TAF1 Antibody - middle region : Biotin (ARP32472_P050-Biotin)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "215kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "TAF1 Antibody - middle region : Biotin (ARP32472_P050-Biotin)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "TAF1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "TAF1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "TAF1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "TAF1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "TAF1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "TAF1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:TAF1 Antibody - middle region : Biotin (ARP32472_P050-Biotin)
Your Rating
We found other products you might like!