Size:100 ul
$289.00
In Stock
SKU
ARP32473_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP32473_P050-FITC Conjugated

ARP32473_P050-HRP Conjugated

ARP32473_P050-Biotin Conjugated

TAF1 Antibody - C-terminal region (ARP32473_P050)

Catalog#: ARP32473_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human, Mouse
Predicted Species Reactivity Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB, CHIP
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-17134 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human TAF1
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data Anti-TAF1 (ARP32473_P050)
Peptide Sequence Synthetic peptide located within the following region: YEVSEEEEDEEEEEQRSGPSVLSQVHLSEDEEDSEDFHSIAGDSDLDSDE
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-TAF1 (ARP32473_P050) antibody is Catalog # AAP32473 (Previous Catalog # AAPS25101)
Datasheets/Manuals Printable datasheet for anti-TAF1 (ARP32473_P050) antibody
Sample Type Confirmation

TAF1 is strongly supported by BioGPS gene expression data to be expressed in Daudi

Subunit 1
Target Reference Lively,T.N., et al., (2004) J. Biol. Chem. 279 (25), 26257-26265
Gene Symbol TAF1
Official Gene Full Name TAF1 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 250kDa
Alias Symbols BA2R, CCG1, CCGS, DYT3, KAT4, NSCL2, OF, P250, TAF2A, TAFII250, XDP, N-TAF1, DYT3/TAF1
NCBI Gene Id 6872
Protein Name Transcription initiation factor TFIID subunit 1
Description of Target Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is the basal transcription factor TFIID, which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. TAF1 encodes the largest subunit of TFIID. This subunit binds to core promoter sequences encompassing the transcription start site. It also binds to activators and other transcriptional regulators, and these interactions affect the rate of transcription initiation. This subunit contains two independent protein kinase domains at the N and C-terminals, but also possesses acetyltransferase activity and can act as a ubiquitin-activating/conjugating enzyme.Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is the basal transcription factor TFIID, which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes the largest subunit of TFIID. This subunit binds to core promoter sequences encompassing the transcription start site. It also binds to activators and other transcriptional regulators, and these interactions affect the rate of transcription initiation. This subunit contains two independent protein kinase domains at the N and C-terminals, but also possesses acetyltransferase activity and can act as a ubiquitin-activating/conjugating enzyme. Two transcripts encoding different isoforms have been identified for this gene.
Swissprot Id P21675-2
Protein Accession # NP_620278
Nucleotide Accession # NM_138923
Protein Size (# AA) 1872
Molecular Weight 215kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express TAF1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express TAF1.
Protein Interactions AR; UBE2I; TAF4B; HIST3H3; UBC; TBP; MED26; TAF3; TAF9B; TAF7; TAF6; TAF5; TAF4; TAF2; CCNT1; GFI1B; TP53; MEN1; GTF2F1; BRMS1; PHF8; PAX3; CTCF; HIST1H4A; HIST1H3A; TAF8; MDM2; ASF1A; SIN3A; ALL1; SMARCA2; APC; RANBP2; MAX; TBPL1; TAF13; TAF10; ASF1B; TA
  1. What is the species homology for "TAF1 Antibody - C-terminal region (ARP32473_P050)"?

    The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat".

  2. How long will it take to receive "TAF1 Antibody - C-terminal region (ARP32473_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "TAF1 Antibody - C-terminal region (ARP32473_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "TAF1 Antibody - C-terminal region (ARP32473_P050)"?

    This target may also be called "BA2R, CCG1, CCGS, DYT3, KAT4, NSCL2, OF, P250, TAF2A, TAFII250, XDP, N-TAF1, DYT3/TAF1" in publications.

  5. What is the shipping cost for "TAF1 Antibody - C-terminal region (ARP32473_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "TAF1 Antibody - C-terminal region (ARP32473_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "TAF1 Antibody - C-terminal region (ARP32473_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "215kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "TAF1 Antibody - C-terminal region (ARP32473_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "TAF1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "TAF1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "TAF1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "TAF1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "TAF1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "TAF1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:TAF1 Antibody - C-terminal region (ARP32473_P050)
Your Rating
We found other products you might like!