Search Antibody, Protein, and ELISA Kit Solutions

TAF1 Antibody - middle region (ARP32472_P050)

100 ul

Regular Price: $319.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP32472_P050-FITC Conjugated

ARP32472_P050-HRP Conjugated

ARP32472_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB, CHIP
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-17134 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human TAF1
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-TAF1 (ARP32472_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MMSYEGDGGEASHGLEDSNISYGSYEEPDPKSNTQDTSFSSIGGYEVSEE
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-TAF1 (ARP32472_P050) antibody is Catalog # AAP32472 (Previous Catalog # AAPP03470)
Datasheets/Manuals:
Printable datasheet for anti-TAF1 (ARP32472_P050) antibody
Subunit:
1
Target Reference:
Herzfeld,T., (2007) Mamm. Genome 18 (11), 787-795
Gene Symbol:
TAF1
Official Gene Full Name:
TAF1 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 250kDa
Alias Symbols:
BA2R, CCG1, CCGS, DYT3, KAT4, NSCL2, OF, P250, TAF2A, TAFII250, XDP, N-TAF1, DYT3/TAF1
NCBI Gene Id:
6872
Protein Name:
Transcription initiation factor TFIID subunit 1
Description of Target:
Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is the basal transcription factor TFIID, which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. TAF1 encodes the largest subunit of TFIID. This subunit binds to core promoter sequences encompassing the transcription start site. It also binds to activators and other transcriptional regulators, and these interactions affect the rate of transcription initiation. This subunit contains two independent protein kinase domains at the N and C-terminals, but also possesses acetyltransferase activity and can act as a ubiquitin-activating/conjugating enzyme. Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is the basal transcription factor TFIID, which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes the largest subunit of TFIID. This subunit binds to core promoter sequences encompassing the transcription start site. It also binds to activators and other transcriptional regulators, and these interactions affect the rate of transcription initiation. This subunit contains two independent protein kinase domains at the N and C-terminals, but also possesses acetyltransferase activity and can act as a ubiquitin-activating/conjugating enzyme. Two transcripts encoding different isoforms have been identified for this gene.
Swissprot Id:
P21675-2
Protein Accession #:
NP_004597
Nucleotide Accession #:
NM_004606
Protein Size (# AA):
1893
Molecular Weight:
215kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TAF1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TAF1.
Protein Interactions:
AR; UBE2I; TAF4B; HIST3H3; UBC; TBP; MED26; TAF3; TAF9B; TAF7; TAF6; TAF5; TAF4; TAF2; CCNT1; GFI1B; TP53; MEN1; GTF2F1; BRMS1; PHF8; PAX3; CTCF; HIST1H4A; HIST1H3A; TAF8; MDM2; ASF1A; SIN3A; ALL1; SMARCA2; APC; RANBP2; MAX; TBPL1; TAF13; TAF10; ASF1B; TA

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...