SULT1A3 Antibody (OAAL00320)

Catalog No: OAAL00320

Size:100UG

Detection limit for recombinant GST tagged SULT1A3 is 0.3 ng/ml as a capture antibody.

Product Info

• Predicted Species Reactivity: Human, Mouse
• Product Format: Liquid
• Clonality: Monoclonal
• Clone: 1F3
• Isotype: IgG1 Kappa
• Host: Mouse
• Application: Enzyme-linked immunosorbent assay|Western blot
• Reconstitution and Storage: Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
• Immunogen: SULT1A3 (AAH14471, 1 a.a. ~ 295 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Peptide Sequence: MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLINTYPKSGTTWVSQILDMIYQGGDLEKCNRAPIYVRVPFLEVNDPGEPSGLETLKDTPPPRLIKSHLPLALLPQTLLDQKVKVVYVARNPKDVAVSYYHFHRMEKAHPEPGTWDSFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETMDFMVQHTSFKEMKKNPMTNYTTVPQELMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL
• Formulation: In 1x PBS, pH 7.4

Target Info

• Gene Symbol: SULT1A3
• Gene Full Name: sulfotransferase family 1A member 3
• Alias Symbols: aryl sulfotransferase 1A3/1A4;catecholamine-sulfating phenol sulfotransferase;dopamine-specific sulfotransferase;HAST;HAST3;monoamine-sulfating phenosulfotransferase;M-PST;phenol sulfotransferase 1A5;placental estrogen sulfotransferase;ST1A3;ST1A3/ST1A4;ST1A4;ST1A5;STM;sulfokinase;sulfotransferase 1A3;Sulfotransferase 1A4;sulfotransferase family, cytosolic, 1A, phenol-preferring, member 3;thermolabile (monoamine, M form) phenol sulfotransferase;TL-PST.
• NCBI Gene Id: 6818
• Protein Name: Homo sapiens sulfotransferase family, cytosolic, 1A, phenol-preferring, member 4, mRNA (cDNA clone MGC:23115 IMAGE:4907290), complete cds|Sulfotransferase family, cytosolic, 1A, phenol-preferring, member 4 [Homo sapiens]
• Description of Target: Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes a phenol sulfotransferase with thermolabile enzyme activity. Four sulfotransferase genes are located on the p arm of chromosome 16; this gene and SULT1A4 arose from a segmental duplication. This gene is the most centromeric of the four sulfotransferase genes. Exons of this gene overlap with exons of a gene that encodes a protein containing GIY-YIG domains (GIYD1). Multiple alternatively spliced variants that encode the same protein have been described. [provided by RefSeq
• Protein Accession #: https://www.ncbi.nlm.nih.gov/protein/AAH14471
• Nucleotide Accession #: https://www.ncbi.nlm.nih.gov/nuccore/BC014471