RIPK3 Antibody - middle region (AVARP00031_P050)

Catalog No: AVARP00031_P050

WB Suggested Anti-RIPK3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: PANC1 cell lysate

Spleen

Host: Rat
Target Name: RIPK3
Sample Tissue: Rat Brain
Antibody Dilution: 1ug/ml

25 ug of the indicated Mouse or Rat tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. Protein may be phosporylated, and the peptide has 92% identity for the rat Ripk3 sequence.

Product Info

• Tested Species Reactivity: Human, Rat
• Predicted Species Reactivity: Human, Rat, Dog, Horse
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RIPK3
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Dog: 92%; Horse: 92%; Human: 100%; Rat: 92%
• Peptide Sequence: Synthetic peptide located within the following region: ETPGLEGLKELMQLCWSSEPKDRPSFQECLPKTDEVFQMVENNMNAAVST
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-RIPK3 (AVARP00031_P050) antibody is Catalog # AAP30514 (Previous Catalog # AAPP01150)
• Enhanced Validation:

  Relative Expression (Western Blot)

Target Info

• Reference: Cerhan,J.R., (2007) Blood 110 (13), 4455-4463
• Gene Symbol: RIPK3
• Gene Full Name: Receptor-interacting serine-threonine kinase 3
• Alias Symbols: RIP3
• NCBI Gene Id: 11035
• Protein Name: Receptor-interacting serine/threonine-protein kinase 3
• Description of Target: RIPK3 is a member of the receptor-interacting protein (RIP) family of serine/threonine protein kinases, and contains a C-terminal domain unique from other RIP family members. The protein is predominantly localized to the cytoplasm, and can undergo nucleocytoplasmic shuttling dependent on novel nuclear localization and export signals. It is a component of the tumor necrosis factor (TNF) receptor-I signaling complex, and can induce apoptosis and weakly activate the NF-kappaB transcription factor. The product of this gene is a member of the receptor-interacting protein (RIP) family of serine/threonine protein kinases, and contains a C-terminal domain unique from other RIP family members. The encoded protein is predominantly localized to the cytoplasm, and can undergo nucleocytoplasmic shuttling dependent on novel nuclear localization and export signals. It is a component of the tumor necrosis factor (TNF) receptor-I signaling complex, and can induce apoptosis and weakly activate the NF-kappaB transcription factor. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Uniprot ID: Q9Y572
• Protein Accession #: NP_006862
• Nucleotide Accession #: NM_006871
• Protein Size (# AA): 518
• Molecular Weight: 52 kDa
• Protein Interactions: BMH1; RFX6; FADD; RIPK1; CASP8; INPP5K; CDC37; STIP1; PYGL; FKBP5; FKBP4; CTNND1; UBC; XIAP; BIRC3; BIRC2; TICAM1; TRAF2; TNFRSF1A;