Catalog No: ARP31513_T100
Price: $0.00
SKU
ARP31513_T100
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-RIPK3 (ARP31513_T100) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Horse, Pig
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ConjugationUnconjugated
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human RIPK3
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 79%; Dog: 93%; Horse: 86%; Human: 100%; Mouse: 86%; Pig: 86%; Rat: 91%
Peptide SequenceSynthetic peptide located within the following region: GGSQSGTGSGEPGGTLGYLAPELFVNVNRKASTASDVYSFGILMWAVLAG
Concentration1.0 mg/ml
Blocking PeptideFor anti-RIPK3 (ARP31513_T100) antibody is Catalog # AAP31513 (Previous Catalog # AAPP24084)
Enhanced Validation
WBY
SPR
YCHAROS
ReferenceKimura,K., (2006) Genome Res. 16 (1), 55-65
Publications

Mesenchymal Stem/Stromal Cells and their Extracellular Vesicle Progeny Decrease Injury in Poststenotic Swine Kidney Through Different Mechanisms. Stem Cells Dev. 29, 1190-1200 (2020)

Gene SymbolRIPK3
Gene Full NameReceptor-interacting serine-threonine kinase 3
Alias SymbolsRIP3
NCBI Gene Id11035
Protein NameReceptor-interacting serine/threonine-protein kinase 3
Description of TargetRIPK3 is a member of the receptor-interacting protein (RIP) family of serine/threonine protein kinases, and contains a C-terminal domain unique from other RIP family members. The protein is predominantly localized to the cytoplasm, and can undergo nucleocytoplasmic shuttling dependent on novel nuclear localization and export signals. It is a component of the tumor necrosis factor (TNF) receptor-I signaling complex, and can induce apoptosis and weakly activate the NF-kappaB transcription factor.The product of this gene is a member of the receptor-interacting protein (RIP) family of serine/threonine protein kinases, and contains a C-terminal domain unique from other RIP family members. The encoded protein is predominantly localized to the cytoplasm, and can undergo nucleocytoplasmic shuttling dependent on novel nuclear localization and export signals. It is a component of the tumor necrosis factor (TNF) receptor-I signaling complex, and can induce apoptosis and weakly activate the NF-kappaB transcription factor.
Uniprot IDQ9Y572
Protein Accession #NP_006862
Nucleotide Accession #NM_006871
Protein Size (# AA)518
Molecular Weight57 kDa
Protein InteractionsBMH1; RFX6; FADD; RIPK1; CASP8; INPP5K; CDC37; STIP1; PYGL; FKBP5; FKBP4; CTNND1; UBC; XIAP; BIRC3; BIRC2; TICAM1; TRAF2; TNFRSF1A;
  1. What is the species homology for "RIPK3 Antibody - N-terminal region (ARP31513_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Horse, Pig".

  2. How long will it take to receive "RIPK3 Antibody - N-terminal region (ARP31513_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "RIPK3 Antibody - N-terminal region (ARP31513_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "RIPK3 Antibody - N-terminal region (ARP31513_T100)"?

    This target may also be called "RIP3" in publications.

  5. What is the shipping cost for "RIPK3 Antibody - N-terminal region (ARP31513_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "RIPK3 Antibody - N-terminal region (ARP31513_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "RIPK3 Antibody - N-terminal region (ARP31513_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "57 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "RIPK3 Antibody - N-terminal region (ARP31513_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "RIPK3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "RIPK3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "RIPK3"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "RIPK3"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "RIPK3"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "RIPK3"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:RIPK3 Antibody - N-terminal region (ARP31513_T100)
Your Rating
We found other products you might like!