Search Antibody, Protein, and ELISA Kit Solutions

RBX1 Antibody - middle region (AVARP03042_T100)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

AVARP03042_T100-FITC Conjugated

AVARP03042_T100-HRP Conjugated

AVARP03042_T100-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Ring-box 1, E3 ubiquitin protein ligase
NCBI Gene Id:
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
ROC1, RNF75, BA554C12.1
Replacement Item:
This antibody may replace item sc-366959 from Santa Cruz Biotechnology.
Description of Target:
ROC1 encodes an evolutionarily conserved protein that interacts with cullins. The protein plays a unique role in the ubiquitination reaction by heterodimerizing with cullin-1 to catalyze ubiquitin polymerization. It also may be involved in the regulation of protein turn-over.
Protein Size (# AA):
Molecular Weight:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express RBX1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express RBX1.
The immunogen is a synthetic peptide directed towards the middle region of human RBX1
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Human, Mouse, Rat, Zebrafish
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-RBX1 (AVARP03042_T100)
Peptide Sequence:
Synthetic peptide located within the following region: NQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-RBX1 (AVARP03042_T100) antibody is Catalog # AAP30461 (Previous Catalog # AAPP01045)
Printable datasheet for anti-RBX1 (AVARP03042_T100) antibody
Target Reference:
Zheng, N., et al., (2002) Nature 416 (6882), 703-709.

Maerki, S. et al. The Cul3-KLHL21 E3 ubiquitin ligase targets aurora B to midzone microtubules in anaphase and is required for cytokinesis. J. Cell Biol. 187, 791-800 (2009). WB, Cow, Dog, Guinea Pig, Human, Mouse, Rat, Zebrafish 19995937

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...